DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43155 and KCNK10

DIOPT Version :9

Sequence 1:NP_572720.2 Gene:CG43155 / 32092 FlyBaseID:FBgn0262685 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_612190.1 Gene:KCNK10 / 54207 HGNCID:6273 Length:543 Species:Homo sapiens


Alignment Length:416 Identity:116/416 - (27%)
Similarity:178/416 - (42%) Gaps:99/416 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 KGTAGGRRSTACWQSMKWKSALNHIGLLVSLSIYCGVGGLIFRHLERPAEVERLSHLKDIVKTHR 106
            :||:.|...|.    ||||:.   :.:.|.:.:|...|||:||.||:|.|    |..|:.:...:
Human    61 EGTSQGGLQTV----MKWKTV---VAIFVVVVVYLVTGGLVFRALEQPFE----SSQKNTIALEK 114

  Fly   107 ERFL--HTILNNTEVHNLDELLSFELAKYEAAVQQAAEGGLLIVADKDFPEPY-------ERWSI 162
            ..||  |..::..|:              |..:|.|.:      ||.....|.       ..|.:
Human   115 AEFLRDHVCVSPQEL--------------ETLIQHALD------ADNAGVSPIGNSSNNSSHWDL 159

  Fly   163 LQAVFFSSTVLTTIGYGNIVPVTTGGRVFCICFALIGIP---FTLTVIAD-----WGRLFATAVS 219
            ..|.||:.||:||||||||.|.|.||::|||.:|:.|||   |.|..|.|     :|:..|....
Human   160 GSAFFFAGTVITTIGYGNIAPSTEGGKIFCILYAIFGIPLFGFLLAGIGDQLGTIFGKSIARVEK 224

  Fly   220 VFGKHMPTKPKFTNFIGKTWFYAILAVGFLGVYLAAGAGLLLLWEDDWTFFDGFYFCFITMTTIG 284
            ||.|...::.|. ..|....|  |||...:.|.:.|   ::..:.:.||..:..||..:|:||:|
Human   225 VFRKKQVSQTKI-RVISTILF--ILAGCIVFVTIPA---VIFKYIEGWTALESIYFVVVTLTTVG 283

  Fly   285 FGDLVP-------KKPNYMLLCTLYILIGLALTSTIIELVR-----------------RQYATSW 325
            |||.|.       .:..|..|...:||:|||..:.::.::.                 :.:|..|
Human   284 FGDFVAGGNAGINYREWYKPLVWFWILVGLAYFAAVLSMIGDWLRVLSKKTKEEVGEIKAHAAEW 348

  Fly   326 AKLQELSGPMAETLRRLGETAGTGLDYTALQKVLTV-SMP--KWNSKKNEHSPDI---------A 378
            .  ..::....||.|||....     :..||:..|: ||.  :....:..||.|:         |
Human   349 K--ANVTAEFRETRRRLSVEI-----HDKLQRAATIRSMERRRLGLDQRAHSLDMLSPEKRSVFA 406

  Fly   379 ALEAITNAILKEVKEAQNNKPKVLQI 404
            ||:  |.......:|:.||:|..|::
Human   407 ALD--TGRFKASSQESINNRPNNLRL 430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43155NP_572720.2 Ion_trans_2 <157..214 CDD:285168 30/71 (42%)
Ion_trans <240..314 CDD:278921 25/80 (31%)
Ion_trans_2 <266..319 CDD:285168 19/76 (25%)
KCNK10NP_612190.1 Ion_trans_2 153..211 CDD:285168 29/57 (51%)
Ion_trans_2 249..328 CDD:285168 21/81 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X19
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.