DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43155 and Kcnk6

DIOPT Version :9

Sequence 1:NP_572720.2 Gene:CG43155 / 32092 FlyBaseID:FBgn0262685 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_001028697.2 Gene:Kcnk6 / 52150 MGIID:1891291 Length:313 Species:Mus musculus


Alignment Length:338 Identity:91/338 - (26%)
Similarity:146/338 - (43%) Gaps:69/338 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 LLVSLSIYCG---VGGLIFRHLERPAEVERLSHLKDIVKTHRERFL-HTILNNTEVHNLDELLSF 128
            |..:|:.|.|   :|.|:...||||.|    :.|:..:.|.||:.| |:..  ...|.||..:..
Mouse     7 LASALAAYAGYLALGALLVARLERPHE----ARLRAELGTLREQLLQHSPC--VAAHALDAFVER 65

  Fly   129 ELAKYEAAVQQAAEGGLLIVADKDFPEPYERWSILQAVFFSSTVLTTIGYGNIVPVTTGGRVFCI 193
            .||  ...:.:||.......|:...|    .|....|:||:||::||:|||...|:|..|:.|.|
Mouse    66 VLA--AGRLGRAALANASGAANASDP----AWDFASALFFASTLVTTVGYGYTTPLTDAGKAFSI 124

  Fly   194 CFALIGIPFTLTVIADWGRLFATAVSVFGKHMPTK---------PKFTNFIGKTWFYAILAVGFL 249
            .|||:|:|.|:.::.    ..|..:|:...|.|..         |:    ....|....|.:..:
Mouse   125 VFALLGVPITMLLLT----ASAQRLSLLLTHAPLSWLSLHWGWPPQ----RAARWHLVALLMVIV 181

  Fly   250 GVYLAAGAGLLLLWEDDWTFFDGFYFCFITMTTIGFGDLVP-KKPN------YMLLCTLYILIGL 307
            .::....|.:....|:.|:|.|.||||||:::|||.||.|| :.|.      |.:|.|.|:.:||
Mouse   182 AIFFLVPAAVFAYLEEAWSFLDAFYFCFISLSTIGLGDYVPGEAPGQPYRALYKVLVTAYLFLGL 246

  Fly   308 ALTSTIIELVRRQYATSWAKLQELSGPMAETLRRLGETAGTGLDYTALQKVLTVSMPKWNSKKNE 372
            .....::                      :|.||:.:..|       |.:::.:..|...|...:
Mouse   247 VAMVLVL----------------------QTFRRVSDLHG-------LTELILLPDPDPASLSQD 282

  Fly   373 HSPDIAALEAITN 385
            ....:|.|:|.|:
Mouse   283 EDDQVAVLDARTD 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43155NP_572720.2 Ion_trans_2 <157..214 CDD:285168 22/56 (39%)
Ion_trans <240..314 CDD:278921 26/80 (33%)
Ion_trans_2 <266..319 CDD:285168 23/59 (39%)
Kcnk6NP_001028697.2 Ion_trans_2 <91..146 CDD:285168 23/58 (40%)
Ion_trans <171..253 CDD:278921 27/81 (33%)
Ion_trans_2 180..259 CDD:285168 27/100 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4331
SonicParanoid 1 1.000 - - X19
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.