DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43155 and kcnk6

DIOPT Version :9

Sequence 1:NP_572720.2 Gene:CG43155 / 32092 FlyBaseID:FBgn0262685 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_001025245.2 Gene:kcnk6 / 504083 ZFINID:ZDB-GENE-050309-213 Length:315 Species:Danio rerio


Alignment Length:300 Identity:79/300 - (26%)
Similarity:143/300 - (47%) Gaps:61/300 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 SMKWKSALNHIGLLVSLSIYCGVGGLIFRHLERPAEVERLSHLKDIVKTHRERFLH-TILNNTEV 119
            |..::|....||.:::...|..:|.|:|..:|||.|    ..||..:.:.:..||: :.:|:|.:
Zfish     2 STAFRSCFMLIGFILAYFTYLLLGALVFSAIERPIE----ESLKADLSSLKAEFLNLSCVNSTAL 62

  Fly   120 HN-LDELLSFELAKYEAAVQQAAEGGLLIVADKDFPEPYERWSILQAVFFSSTVLTTIGYGNIVP 183
            .. |:.:|  :..||..:|.:.|             .....|.:..::||::|::||:|||:..|
Zfish    63 ETFLERVL--KANKYGVSVLENA-------------SLRTNWDLASSLFFANTMVTTVGYGHTTP 112

  Fly   184 VTTGGRVFCICFALIGIPFTLTVIADWGR-----LFATAVSVFGKHMPTKPKFTN--------FI 235
            ::..|:.|.|.:||||:|||:.|:....:     |....:|...:....:.:..:        |:
Zfish   113 LSDAGKAFSIVYALIGVPFTMLVLTACVQRLMHPLTYRPISACQRRAGLQQRSASVVHFIVLLFL 177

  Fly   236 GKTWFYAILAVGFLGVYLAAGAGLLLLWEDDWTFFDGFYFCFITMTTIGFGDLVP-KKPN----- 294
            ....|:.:.::.|..:            |:.|:|.|.||||||::.|||.||.|| :||.     
Zfish   178 VVLCFFVVPSLVFSAI------------EETWSFLDAFYFCFISLCTIGLGDFVPAEKPGQSLRA 230

  Fly   295 -YMLLCTLYILIGLALTSTIIELVRRQYATSWAKLQELSG 333
             |.:...:|:.:||    .::.||.|    ::.||.::.|
Zfish   231 LYKISVMVYLFVGL----MVMFLVLR----TFHKLADVYG 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43155NP_572720.2 Ion_trans_2 <157..214 CDD:285168 21/61 (34%)
Ion_trans <240..314 CDD:278921 25/80 (31%)
Ion_trans_2 <266..319 CDD:285168 24/59 (41%)
kcnk6NP_001025245.2 Ion_trans_2 84..145 CDD:285168 21/60 (35%)
Ion_trans_2 178..254 CDD:285168 28/95 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4331
SonicParanoid 1 1.000 - - X19
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.