DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43155 and kcnk1

DIOPT Version :9

Sequence 1:NP_572720.2 Gene:CG43155 / 32092 FlyBaseID:FBgn0262685 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_001011490.1 Gene:kcnk1 / 496985 XenbaseID:XB-GENE-5846322 Length:330 Species:Xenopus tropicalis


Alignment Length:309 Identity:86/309 - (27%)
Similarity:133/309 - (43%) Gaps:75/309 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 RRSTACWQSMKWKSALNHIGLLVSLSIYCGVGGLIFRHLERPAE---VERLSHLKDIVKTHRERF 109
            :|:..||         ..:.|::...::..:|..||..:|.|.|   .|.|..||          
 Frog    15 QRNQTCW---------CFVLLMLGYLLFLLIGAAIFSAVELPHEHVLREELLDLK---------- 60

  Fly   110 LHTILNNTEVHNLDELLSF-----ELAKYEAAVQQAAEGGLLIVADKDFPEPYERWSILQAVFFS 169
             |..|...|..:.:.|.||     |.:.|..::.....|.             ..|....|:||.
 Frog    61 -HRYLQENECLSEERLESFLSRVLEASNYGVSMLNNVSGN-------------PNWDFTSALFFV 111

  Fly   170 STVLTTIGYGNIVPVTTGGRVFCICFALIGIPFTLTVIADWGRLFATAVSVFGKHMPTKPKFTNF 234
            ||||:|.|||:.||::..|:.|||.:::||||.||.       ||...|.....|:..:|  .::
 Frog   112 STVLSTTGYGHTVPLSNAGKTFCIIYSIIGIPLTLL-------LFTALVQRIMVHVTHRP--ISY 167

  Fly   235 IGKTWFY-----AI---LAVGFLGV--YLAAGAGLLLLWEDDWTFFDGFYFCFITMTTIGFGDLV 289
            ....|.|     |:   |.:||:.:  :....|.:....||||.|.:.||||||:::|||.||.|
 Frog   168 FHLRWGYNKQTVAVVHALVIGFVAILCFFLIPAAIFSALEDDWNFLESFYFCFISLSTIGLGDYV 232

  Fly   290 PKKPN-------YMLLCTLYILIGLALTSTIIELVRRQYATSWAKLQEL 331
            |.:..       |....|.|:::||.:...::|        ::.:||.|
 Frog   233 PAEGQNQRYRQLYKFGITCYLILGLIVMLVVLE--------TFCELQGL 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43155NP_572720.2 Ion_trans_2 <157..214 CDD:285168 24/56 (43%)
Ion_trans <240..314 CDD:278921 29/90 (32%)
Ion_trans_2 <266..319 CDD:285168 22/59 (37%)
kcnk1NP_001011490.1 Ion_trans_2 <101..157 CDD:311712 27/62 (44%)
Ion_trans_2 192..267 CDD:311712 25/82 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4331
SonicParanoid 1 1.000 - - X19
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.