DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43155 and CG10864

DIOPT Version :9

Sequence 1:NP_572720.2 Gene:CG43155 / 32092 FlyBaseID:FBgn0262685 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_650726.1 Gene:CG10864 / 42222 FlyBaseID:FBgn0038621 Length:389 Species:Drosophila melanogaster


Alignment Length:361 Identity:79/361 - (21%)
Similarity:140/361 - (38%) Gaps:80/361 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 GGLAKGTAGGRRSTACWQSMKWKSAL------------NHIGLLVSLSIYCGVGGLIFRHLERPA 90
            ||.. |..||..|.:...|.:.:..:            ..:|:...:.||...|...|.|:||..
  Fly    12 GGTV-GMGGGPSSVSSTPSNQPRKRVKRCCRNFVTFMCTQVGVGALIVIYAICGAFAFMHIERQF 75

  Fly    91 EVERLSHLKDIVKTHRERFLHTILNNTEVHNL------DELLSFELAKYEAAVQQAAEGGLLIVA 149
            ..|...|:.::    |:.....:.:.||.||:      .|..:..|.:|::.:....:.|.:   
  Fly    76 VDETAGHVMEL----RQNCSQQLWSITEQHNIIDRRRWTEATNDVLREYQSQIAGVVKHGYV--- 133

  Fly   150 DKDFPEPYERWSILQAVFFSSTVLTTIGYGNIVPVTTGGRVFCICFALIGIPFTLTVIADWGRLF 214
               ...|.:.||...|:.|..:|:|.|||||:||.|..|:.|.:.:|..|||..:....:.||:.
  Fly   134 ---GRSPEQIWSFPAALMFCLSVITMIGYGNMVPRTPWGKGFTVIYATFGIPLYILYFLNMGRVL 195

  Fly   215 ATAVSVFGK--HMPTK--PKFTNF------IGKTWFYAIL----AVGFLGVYLAAGAGLLLLWED 265
            |.:.....:  |..|:  |:....      :|.|....|:    .:..:..|:..|..:...|| 
  Fly   196 ARSFKFLYRSLHDCTQEHPRLDRMDALEGGVGMTRKKVIVPSTACLWVIFFYVLTGTVMFANWE- 259

  Fly   266 DWTFFDGFYFCFITMTTIGFGDLVP------------------------------------KKPN 294
            .|:..:.||||..::..|||||.||                                    .:.:
  Fly   260 KWSLLNSFYFCMTSLCKIGFGDFVPGASLTTSADVNAATQKLQEDISADPAELAQLQSVAADQHS 324

  Fly   295 YMLLCTLYILIGLALTSTIIELVRRQYATSWAKLQE 330
            .:.:..:|:|:|:.|.:....|:|.:......:::|
  Fly   325 KLAINFVYMLLGMGLVAMCRNLMREEVRLKAREMRE 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43155NP_572720.2 Ion_trans_2 <157..214 CDD:285168 22/56 (39%)
Ion_trans <240..314 CDD:278921 21/113 (19%)
Ion_trans_2 <266..319 CDD:285168 17/88 (19%)
CG10864NP_650726.1 Ion_trans_2 124..197 CDD:285168 24/78 (31%)
Ion_trans_2 242..>284 CDD:285168 14/42 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45461286
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1418
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D542195at33208
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.