DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43155 and Task7

DIOPT Version :9

Sequence 1:NP_572720.2 Gene:CG43155 / 32092 FlyBaseID:FBgn0262685 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_649891.1 Gene:Task7 / 41125 FlyBaseID:FBgn0037690 Length:340 Species:Drosophila melanogaster


Alignment Length:291 Identity:87/291 - (29%)
Similarity:134/291 - (46%) Gaps:56/291 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 IGLLVSLSIYCGVGGLIFRHLERPAEVERLSHLKDIVKTHRERFLHTILNNTEVHNLDELLSFEL 130
            :.|:|....|..:|..:|..||.|.|.:|.            .||.|:.||.            :
  Fly    10 LSLVVCTFTYLLIGAAVFDSLESPTEAKRW------------EFLQTVKNNF------------V 50

  Fly   131 AKYEAAVQQAAEGGLLIVADKDFPEPYE---RWSILQAVFFSSTVLTTIGYGNIVPVTTGGRVFC 192
            .||....:......::|:.:|    |::   :|....|.:||:.||..||||:..|||..|:.||
  Fly    51 RKYNVTDEDFRVMEIVIIENK----PHKAGPQWKFAGAFYFSTVVLAMIGYGHSTPVTIPGKAFC 111

  Fly   193 ICFALIGIPFTLTVIADWG-RL--FATAVSVFGKHMPTKPKFTNFIGKTWFYAILAVGFL-GVYL 253
            :.:|::|||..|.:....| ||  ||:.:....|    :.........|....:||.|.| .:.:
  Fly   112 MGYAMVGIPLGLVMFQSIGERLNKFASVIIRRAK----RASGARCTDATEMNLMLATGMLSSIII 172

  Fly   254 AAGAGLLLLWEDDWTFFDGFYFCFITMTTIGFGDLV--------PKKPNYMLLCTLYILIGLALT 310
            ..||.:...:| .|::||.||:||:|:|||||||.|        ..||.|:.|..::||.|||:.
  Fly   173 TTGAAVFSRYE-GWSYFDSFYYCFVTLTTIGFGDYVALQNDQALTNKPGYVALSLVFILFGLAVV 236

  Fly   311 STIIELVRRQYATSWAK--------LQELSG 333
            :..|.|:..::.|..|:        .|.|:|
  Fly   237 AASINLLVLRFMTMQAEDAKRDEQDAQNLAG 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43155NP_572720.2 Ion_trans_2 <157..214 CDD:285168 24/62 (39%)
Ion_trans <240..314 CDD:278921 32/82 (39%)
Ion_trans_2 <266..319 CDD:285168 27/60 (45%)
Task7NP_649891.1 Ion_trans_2 <78..133 CDD:285168 22/54 (41%)
Ion_trans_2 166..248 CDD:285168 31/82 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45461283
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X19
54.940

Return to query results.
Submit another query.