DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43155 and kcnk5b

DIOPT Version :9

Sequence 1:NP_572720.2 Gene:CG43155 / 32092 FlyBaseID:FBgn0262685 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_956927.1 Gene:kcnk5b / 393606 ZFINID:ZDB-GENE-040426-1297 Length:448 Species:Danio rerio


Alignment Length:266 Identity:86/266 - (32%)
Similarity:122/266 - (45%) Gaps:55/266 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 LLVSLSI-YCGVGGLIFRHLERPAEVERLSHLKDIVKTHRERFLHTILNNTEVHNLDELLSFELA 131
            :|.|:.| |..:|..||:.||.|       :|...|..::.:          .:||       |.
Zfish     7 ILTSVIIFYLSIGAAIFQILEEP-------NLNSAVDDYKNK----------TNNL-------LK 47

  Fly   132 KYEA-----------AVQQAAEGGLLIVADKDFPEPYERWSILQAVFFSSTVLTTIGYGNIVPVT 185
            ||..           .|.:|...|:.:..:..|    ..|:...||.|::||:|||||||:.|.|
Zfish    48 KYPCLSKEVLGEIIEVVAEATGQGVTVTKEAQF----NNWNWENAVIFAATVITTIGYGNVAPKT 108

  Fly   186 TGGRVFCICFALIGIPFTLTVIADWGRLFATAVSVFGK---HMPTKPKFTNFIGKTWFYAILAVG 247
            ||||:|||.:.|.|||..||.|::.|..|.:......:   |.....:...||....|   |..|
Zfish   109 TGGRLFCILYGLCGIPLCLTWISELGTFFGSRTKRLSQLLLHSGLNVRKVQFICTIVF---LLWG 170

  Fly   248 FLGVYLAAGAGLLLLWEDDWTFFDGFYFCFITMTTIGFGDLVP------KKPN-YMLLCTLYILI 305
            || |:|...|.:.:.:| :||:.:|.||.|.|:||:||||.|.      ..|. |.....|:|.:
Zfish   171 FL-VHLIIPAFVFMFFE-NWTYLEGLYFSFTTLTTVGFGDYVAGVDPSVNYPTLYRFFVQLWIYL 233

  Fly   306 GLALTS 311
            |||..|
Zfish   234 GLAWLS 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43155NP_572720.2 Ion_trans_2 <157..214 CDD:285168 30/56 (54%)
Ion_trans <240..314 CDD:278921 31/79 (39%)
Ion_trans_2 <266..319 CDD:285168 22/53 (42%)
kcnk5bNP_956927.1 Ion_trans_2 <81..137 CDD:285168 30/55 (55%)
Ion_trans <142..234 CDD:278921 30/96 (31%)
Ion_trans_2 171..243 CDD:285168 28/71 (39%)
C_Hendra 258..>323 CDD:293426
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 71 1.000 Domainoid score I9409
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X19
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.910

Return to query results.
Submit another query.