DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43155 and Shab

DIOPT Version :10

Sequence 1:NP_572720.2 Gene:CG43155 / 32092 FlyBaseID:FBgn0262685 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_001189037.1 Gene:Shab / 38352 FlyBaseID:FBgn0262593 Length:1607 Species:Drosophila melanogaster


Alignment Length:169 Identity:45/169 - (26%)
Similarity:72/169 - (42%) Gaps:28/169 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 KW---KSALNHIGLLVSLSIYCGVGGL--------IFRHLERPAEVERLSHLKDIVKTHRERFLH 111
            ||   |..||.|.||..|..:..:..|        .|:.:.|..:|.|:..:..|:|..|     
  Fly   529 KWKFFKGGLNIIDLLAILPYFVSLFLLETNKNATDQFQDVRRVVQVFRIMRILRILKLAR----- 588

  Fly   112 TILNNTEVHNLDELLSFELAKYEAAVQQAAEGGLLIVADKDFPEPYER----WSILQAVFFSSTV 172
               ::|.:.:|...|.....:....:...|.|.|:..:...|.|..|:    .||.:..:::...
  Fly   589 ---HSTGLQSLGFTLRNSYKELGLLMLFLAMGVLIFSSLAYFAEKDEKDTKFVSIPETFWWAGIT 650

  Fly   173 LTTIGYGNIVPVTTGGRVF----CICFAL-IGIPFTLTV 206
            :||:|||:|.|.|..|:|.    |||..| |.:|..:.|
  Fly   651 MTTVGYGDIYPTTALGKVIGTVCCICGVLVIALPIPIIV 689

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43155NP_572720.2 Ion_trans_2 143..214 CDD:462301 24/73 (33%)
Ion_trans_2 <267..319 CDD:462301
ShabNP_001189037.1 BTB_POZ_Shab-like 306..414 CDD:349720
Ion_trans 464..700 CDD:459842 45/169 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.