DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43155 and KCNQ2

DIOPT Version :9

Sequence 1:NP_572720.2 Gene:CG43155 / 32092 FlyBaseID:FBgn0262685 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_001369164.1 Gene:KCNQ2 / 3785 HGNCID:6296 Length:890 Species:Homo sapiens


Alignment Length:403 Identity:83/403 - (20%)
Similarity:134/403 - (33%) Gaps:137/403 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 TVKEYDSQDEASTELLE-----------------------------KLKH-------LDRRVDAA 35
            |:|||:...|.:..:||                             :||.       :|..|..|
Human   114 TIKEYEKSSEGALYILEIVTIVVFGVEYFVRIWAAGCCCRYRGWRGRLKFARKPFCVIDIMVLIA 178

  Fly    36 EGGGLAKGTAGGRRSTACWQSMKWKSALNHIGLLVSLSIYCGVGGLIFRHLERPAEVERLSHLKD 100
            ....||.|:.|...:|:..:|:::...|..|.:......:..:|.:::            :|.|:
Human   179 SIAVLAAGSQGNVFATSALRSLRFLQILRMIRMDRRGGTWKLLGSVVY------------AHSKE 231

  Fly   101 IVKTHRERFLHTILNNTEVHNLDELLSFELAKYEAAVQQAAEGGLLIVADKDFPEPYERWSILQA 165
            :|......||..|           |.||                |:.:|:|...:.::.::  .|
Human   232 LVTAWYIGFLCLI-----------LASF----------------LVYLAEKGENDHFDTYA--DA 267

  Fly   166 VFFSSTVLTTIGYGNIVPVTTGGRVFCICFALIGIPFTLTVIADWGRLFATAVSVFG-------- 222
            :::....|||||||:..|.|..||:....|.|||:.|           ||....:.|        
Human   268 LWWGLITLTTIGYGDKYPQTWNGRLLAATFTLIGVSF-----------FALPAGILGSGFALKVQ 321

  Fly   223 -----KHMPTKPK-FTNFIGKTW-FYAILAVGFLGVYLAAGAGLLLLWEDDWTFFDGFYFCFITM 280
                 ||...:.. ....|...| |||.         ..:...|...|:        :|...:|:
Human   322 EQHRQKHFEKRRNPAAGLIQSAWRFYAT---------NLSRTDLHSTWQ--------YYERTVTV 369

  Fly   281 -------TTIGFGDLVPKKPNYMLLCTLYILIGLAL---------TSTIIELVRRQYATSWAKLQ 329
                   .|.|...|:|......||..|....|||.         .|..:.|..|.:::......
Human   370 PMYSSQTQTYGASRLIPPLNQLELLRNLKSKSGLAFRKDPPPEPSPSQKVSLKDRVFSSPRGVAA 434

  Fly   330 ELSG-PMAETLRR 341
            :..| |.|:|:||
Human   435 KGKGSPQAQTVRR 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43155NP_572720.2 Ion_trans_2 <157..214 CDD:285168 17/56 (30%)
Ion_trans <240..314 CDD:278921 18/89 (20%)
Ion_trans_2 <266..319 CDD:285168 14/68 (21%)
KCNQ2NP_001369164.1 Ion_trans 92..324 CDD:395416 53/261 (20%)
KCNQ_channel 448..669 CDD:397540 83/403 (21%)
KCNQ2_u3 684..774 CDD:406935
KCNQC3-Ank-G_bd 786..886 CDD:403240
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D774951at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.