DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43155 and KCNA10

DIOPT Version :10

Sequence 1:NP_572720.2 Gene:CG43155 / 32092 FlyBaseID:FBgn0262685 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_005540.1 Gene:KCNA10 / 3744 HGNCID:6219 Length:511 Species:Homo sapiens


Alignment Length:135 Identity:31/135 - (22%)
Similarity:61/135 - (45%) Gaps:16/135 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   230 KFTNFIGKTWFYAILAVG------FLGVYLAAGAGLLLLWEDDWTFF----DGFYFCFITMTTIG 284
            |....:|:|...::..:|      |:||.|.:.|......::..:.|    |||::..:||||:|
Human   359 KGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEVDEPESHFSSIPDGFWWAVVTMTTVG 423

  Fly   285 FGDLVPKKPNYMLLCTLYILIGLALTSTIIELVRRQY------ATSWAKLQELSGPMAETLRRLG 343
            :||:.|..|...::.||..:.|:...:..:.::...:      .|...:.|.:.|.:...|..:|
Human   424 YGDMCPTTPGGKIVGTLCAIAGVLTIALPVPVIVSNFNYFYHRETENEEKQNIPGEIERILNSVG 488

  Fly   344 ETAGT 348
            ...|:
Human   489 SRMGS 493

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43155NP_572720.2 Ion_trans_2 143..214 CDD:462301
Ion_trans_2 <267..319 CDD:462301 16/55 (29%)
KCNA10NP_005540.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 22..50
BTB_POZ_KCNA10 86..172 CDD:349716
Ion_trans 255..467 CDD:459842 25/107 (23%)
Selectivity filter. /evidence=ECO:0000250 421..426 2/4 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 489..511 1/5 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.