DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43155 and CG34396

DIOPT Version :9

Sequence 1:NP_572720.2 Gene:CG43155 / 32092 FlyBaseID:FBgn0262685 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_611547.2 Gene:CG34396 / 37398 FlyBaseID:FBgn0085425 Length:975 Species:Drosophila melanogaster


Alignment Length:480 Identity:126/480 - (26%)
Similarity:189/480 - (39%) Gaps:126/480 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KKVTVKEYDSQDEASTEL-LEKLKHLDRRVDAAEGGGLAKGTAGGRRSTACWQSMK--------- 58
            ||:..|..|..| .|||| ||||         |..|.|...:...|..   |:.:|         
  Fly   467 KKIQAKGEDVTD-LSTELPLEKL---------ASRGLLYSFSLEARHE---WKRLKLDYPQKVKE 518

  Fly    59 WKSALNH-IGLLVSLSIYCGVGGLIFRHLERPAEVERLSHLKDIVKTHRERFLHTILNNTEVHNL 122
            .:...|. |..|:.:::..|.|||:||:.|..||......::.:.:...:| |..:.:|....:.
  Fly   519 LRQLRNRCIAYLICMAMLLGFGGLLFRYTEGAAENIYKCEVRKVKRDFIDR-LWDVSHNMREEDW 582

  Fly   123 DELLSFELAKYEAAVQQAAEGGLLIVADKDFPEPYERWSILQAVFFSSTVLTTIGYGNIVPVTTG 187
            ..|...:|..:|..:...||.||     :.:| ..:.|:.:....|..||:||||||:|.|.|..
  Fly   583 KSLARQKLRSFEDELNNLAELGL-----RRYP-GQKSWNFVNCFIFCWTVITTIGYGHITPKTGM 641

  Fly   188 GRVFCICFALIGIPFTLTVIADWGRLFATAVS---VFGKHM------------------------ 225
            ||...|.:|:||||..|.|:||.|:||...|.   |:.:.|                        
  Fly   642 GRSLTIVYAIIGIPMFLIVLADLGKLFTRCVKFLWVYVRRMYYTRSCRRIRKQQQIRSAMTGFNT 706

  Fly   226 -----------------------------------------PTKPKFTNFIGKTWFYAILAVG-- 247
                                                     ||.|....|.....|...::|.  
  Fly   707 MYDMAIRRPSMFFSNSAPENDEESQADAEAARSVGTSHPETPTSPYPETFEVDDEFNLPVSVASL 771

  Fly   248 FLGVYLAAGAGLLLLWEDDWTFFDGFYFCFITMTTIGFGDLVPKKPNYMLLCTLYILIGLALTST 312
            .|..|:..|:...|:.|..||..|.||:.||:|:|||||||||..|.|:::..:|::.||||||.
  Fly   772 LLITYILLGSFGFLMMEPSWTPLDAFYYVFISMSTIGFGDLVPSNPFYVMVSMIYLMFGLALTSM 836

  Fly   313 IIELVRRQYATSW----------------AKLQELSGPMAETLRRLGETAGTGLDYTALQKVLTV 361
            .|.:|:.:.:..:                ::|.:..|...:|...|....|:.||        .:
  Fly   837 FINVVQIKLSDHFKMASAKVGATIGMNMTSELGDEGGSQVKTPSELASVHGSRLD--------RI 893

  Fly   362 SMPKWNSKKNEHSPDIAALEAITNA 386
            ......:..|.||| :..|.:|..|
  Fly   894 EEDGQEANGNGHSP-VPPLTSILRA 917

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43155NP_572720.2 Ion_trans_2 <157..214 CDD:285168 26/56 (46%)
Ion_trans <240..314 CDD:278921 33/75 (44%)
Ion_trans_2 <266..319 CDD:285168 28/52 (54%)
CG34396NP_611547.2 RILP-like 135..>217 CDD:304877
Ion_trans_2 <614..670 CDD:285168 28/55 (51%)
Ion_trans_2 771..847 CDD:285168 33/75 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45461289
Domainoid 1 1.000 63 1.000 Domainoid score I10236
eggNOG 1 0.900 - - E1_KOG1418
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D542195at33208
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.