DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43155 and sand

DIOPT Version :9

Sequence 1:NP_572720.2 Gene:CG43155 / 32092 FlyBaseID:FBgn0262685 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_610349.1 Gene:sand / 35777 FlyBaseID:FBgn0033257 Length:395 Species:Drosophila melanogaster


Alignment Length:351 Identity:80/351 - (22%)
Similarity:138/351 - (39%) Gaps:102/351 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 NHIGLLVSLSIYCGVGGLIFRHLERPAEVERLSHLKDIVKTHRERFLHTILNNTEVHNLDELLSF 128
            :::|:::.::.|...|..||:.:| ..|.|||...|.      .||:....:...:..:.||.:.
  Fly    32 SNVGIILLVTFYIIGGAFIFQSIE-IFEYERLKSEKP------HRFIARNFSGECLSRIWELTAE 89

  Fly   129 ELAKYEAAVQQAAEGGLLI-----VADKDFPEP-YERWSILQAVFFSSTVLTTIGYGNIVPVTTG 187
            .::.::....:.....:|:     :..|....| .|:||...|..:|.||:||||||||.|.:..
  Fly    90 NISFFDHHAYRRRVNDVLLDYQRAIVKKQLKGPDVEQWSFSGAFLYSLTVITTIGYGNITPHSEC 154

  Fly   188 GRVFCICFALIGIPFTLTVIADWGRLFA------------------------------------- 215
            |::..|.:|:||:|..|..:::.|.:.|                                     
  Fly   155 GKLVTILYAIIGMPLFLLYLSNIGDVLAKSFKWIYSKVCLCRICPGVAKRRIIRERRKMRQLARA 219

  Fly   216 ---------------TAVSVFGKHMPTKPKFT-----------------------NFIGKTWFYA 242
                           |:.|.......:..::|                       ...|.|....
  Fly   220 LQMHDMENARGSSSYTSTSSTTSSNSSSSEYTRSSRQSSSLVDIQYTESDSDIEREIRGSTDEIT 284

  Fly   243 I---LAVGFLGVYLAAGAGLLLLWEDDWTFFDGFYFCFITMTTIGFGDLVP----------KKPN 294
            :   :.|..:..|:..||.|...|| ||.:.||.|||.|::::||||||||          |...
  Fly   285 VPVTVCVFVMVGYILWGALLFGRWE-DWNYLDGSYFCLISLSSIGFGDLVPGDRVITADRDKVEV 348

  Fly   295 YMLLCTLYILIGLALTSTIIELVRRQ 320
            ..:||.:|:|:|:|:.:....|::.|
  Fly   349 SFILCAIYLLLGMAVIAMCFNLMQEQ 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43155NP_572720.2 Ion_trans_2 <157..214 CDD:285168 24/56 (43%)
Ion_trans <240..314 CDD:278921 30/86 (35%)
Ion_trans_2 <266..319 CDD:285168 24/62 (39%)
sandNP_610349.1 Ion_trans_2 123..183 CDD:285168 24/59 (41%)
Ion_trans_2 292..377 CDD:285168 31/84 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45461287
Domainoid 1 1.000 51 1.000 Domainoid score I4317
eggNOG 1 0.900 - - E1_KOG1418
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D542195at33208
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.