DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43155 and KCNK18

DIOPT Version :9

Sequence 1:NP_572720.2 Gene:CG43155 / 32092 FlyBaseID:FBgn0262685 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_862823.1 Gene:KCNK18 / 338567 HGNCID:19439 Length:384 Species:Homo sapiens


Alignment Length:359 Identity:90/359 - (25%)
Similarity:136/359 - (37%) Gaps:131/359 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 LVSLSIYCGVGGLIFRHLERPAEVERLSHLKDIVKTHRERFLH---TILNNTEVHNLDELLSFEL 130
            |..|..|..||.::|..:|   :.:.|....|   ...|:||.   .|||.:|....|.      
Human    27 LCFLVTYALVGAVVFSAIE---DGQVLVAADD---GEFEKFLEELCRILNCSETVVEDR------ 79

  Fly   131 AKYEAAVQQAAEGGLLIVADKDFPEPYER---WSILQAVFFSSTVLTTIGYGNIVPVTTGGRVFC 192
                   :|..:|.|    .|..|:.:.|   ||.|.::||..||.:|:|||.|.|||..|:..|
Human    80 -------KQDLQGHL----QKVKPQWFNRTTHWSFLSSLFFCCTVFSTVGYGYIYPVTRLGKYLC 133

  Fly   193 ICFALIGIPFTLTVIADWGRLFATAVSV----FGKHMP--TKPKFTNFIGKTWF----------- 240
            :.:||.|||....|:.|.|.:.||.:|.    |.| .|  |:|..:.:..|:.|           
Human   134 MLYALFGIPLMFLVLTDTGDILATILSTSYNRFRK-FPFFTRPLLSKWCPKSLFKKKPDPKPADE 197

  Fly   241 ----------------------------------------------------------------- 240
                                                                             
Human   198 AVPQIIISAEELPGPKLGTCPSRPSCSMELFERSHALEKQNTLQLPPQAMERSNSCPELVLGRLS 262

  Fly   241 YAILA----VG---------------FLGVYLAAGAGLLLLWEDDWTFFDGFYFCFITMTTIGFG 286
            |:|::    ||               .:..|::..|.:|..||....|.:.|||||:|:||||||
Human   263 YSIISNLDEVGQQVERLDIPLPIIALIVFAYISCAAAILPFWETQLDFENAFYFCFVTLTTIGFG 327

  Fly   287 DLVPKKPNYMLLCTLYILIGLALTSTIIELVRRQ 320
            |.|.:.||:.|..::||::|:.:.....:||:.:
Human   328 DTVLEHPNFFLFFSIYIIVGMEIVFIAFKLVQNR 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43155NP_572720.2 Ion_trans_2 <157..214 CDD:285168 26/59 (44%)
Ion_trans <240..314 CDD:278921 31/168 (18%)
Ion_trans_2 <266..319 CDD:285168 23/52 (44%)
KCNK18NP_862823.1 Ion_trans_2 <100..155 CDD:285168 25/54 (46%)
Interaction with calcineurin. /evidence=ECO:0000250 200..205 0/4 (0%)
Interaction with YWHAH. /evidence=ECO:0000250 249..254 0/4 (0%)
Ion_trans_2 288..364 CDD:285168 28/74 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165155113
Domainoid 1 1.000 69 1.000 Domainoid score I9675
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D542195at33208
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.