DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43155 and Kcnk18

DIOPT Version :9

Sequence 1:NP_572720.2 Gene:CG43155 / 32092 FlyBaseID:FBgn0262685 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_997144.1 Gene:Kcnk18 / 332396 MGIID:2685627 Length:394 Species:Mus musculus


Alignment Length:380 Identity:88/380 - (23%)
Similarity:139/380 - (36%) Gaps:138/380 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 LVSLSIYCGVGGLIFRHLE-RP-AEVERLSHLKDIVKTHRERFLHTILNNTEVHNLDELLSFELA 131
            |..|..|..||..:|..:| || .|.|....||        :||..:.|         :|...|.
Mouse    38 LCCLVTYALVGAALFSAVEGRPDPEAEENPELK--------KFLDDLCN---------ILKCNLT 85

  Fly   132 KYEAAVQQAAEGGLLIVADKDFPEPYERWSILQAVFFSSTVLTTIGYGNIVPVTTGGRVFCICFA 196
            ..|.:.:...| .|..:..:....|.: ||.|.|:||..||.:|:|||::.|||..|:..|:.:|
Mouse    86 VVEGSRKNLCE-HLQHLKPQWLKAPQD-WSFLSALFFCCTVFSTVGYGHMYPVTRLGKFLCMLYA 148

  Fly   197 LIGIPFTLTVIADWGRLFATAVS------------------------------------------ 219
            |.|||....|:.|.|.:.||.:|                                          
Mouse   149 LFGIPLMFLVLTDIGDILATILSRAYSRFQALLCLPHDIFKWRSLPLCRKQPDSKPVEEAIPQIV 213

  Fly   220 -------------------------VFGK----------HMPTKPKFTNFIGKTWFYAILAVGFL 249
                                     :|.:          ..||:|     :.::.....|.:|.|
Mouse   214 IDAGVDELLNPQPSKDPPSPSCNVELFERLVAREKKNKLQPPTRP-----VERSNSCPELVLGRL 273

  Fly   250 G-----------------------------VYLAAGAGLLLLWEDDWTFFDGFYFCFITMTTIGF 285
            .                             .|::..|.:|..||.:..|.|.|||||:|:|||||
Mouse   274 SCSILSNLDEVGQQVERLDIPLPVIALVVFAYISCAAAILPFWETELGFEDAFYFCFVTLTTIGF 338

  Fly   286 GDLVPKKPNYMLLCTLYILIGLALTSTIIELVRRQYATSWAKL------QELSGP 334
            ||:|...|::.|..::||::|:.:.....:|::.:...::..|      :|:|.|
Mouse   339 GDIVLVHPHFFLFFSIYIIVGMEILFIAFKLMQNRLLHTYKTLMLFVCQREVSLP 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43155NP_572720.2 Ion_trans_2 <157..214 CDD:285168 25/56 (45%)
Ion_trans <240..314 CDD:278921 29/102 (28%)
Ion_trans_2 <266..319 CDD:285168 22/52 (42%)
Kcnk18NP_997144.1 Ion_trans_2 <111..166 CDD:285168 25/55 (45%)
Interaction with calcineurin 210..215 0/4 (0%)
Interaction with YWHAH. /evidence=ECO:0000269|PubMed:18397886 261..266 0/4 (0%)
Ion_trans_2 300..376 CDD:285168 27/75 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167845577
Domainoid 1 1.000 68 1.000 Domainoid score I9706
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.