Sequence 1: | NP_572720.2 | Gene: | CG43155 / 32092 | FlyBaseID: | FBgn0262685 | Length: | 411 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_997144.1 | Gene: | Kcnk18 / 332396 | MGIID: | 2685627 | Length: | 394 | Species: | Mus musculus |
Alignment Length: | 380 | Identity: | 88/380 - (23%) |
---|---|---|---|
Similarity: | 139/380 - (36%) | Gaps: | 138/380 - (36%) |
- Green bases have known domain annotations that are detailed below.
Fly 69 LVSLSIYCGVGGLIFRHLE-RP-AEVERLSHLKDIVKTHRERFLHTILNNTEVHNLDELLSFELA 131
Fly 132 KYEAAVQQAAEGGLLIVADKDFPEPYERWSILQAVFFSSTVLTTIGYGNIVPVTTGGRVFCICFA 196
Fly 197 LIGIPFTLTVIADWGRLFATAVS------------------------------------------ 219
Fly 220 -------------------------VFGK----------HMPTKPKFTNFIGKTWFYAILAVGFL 249
Fly 250 G-----------------------------VYLAAGAGLLLLWEDDWTFFDGFYFCFITMTTIGF 285
Fly 286 GDLVPKKPNYMLLCTLYILIGLALTSTIIELVRRQYATSWAKL------QELSGP 334 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG43155 | NP_572720.2 | Ion_trans_2 | <157..214 | CDD:285168 | 25/56 (45%) |
Ion_trans | <240..314 | CDD:278921 | 29/102 (28%) | ||
Ion_trans_2 | <266..319 | CDD:285168 | 22/52 (42%) | ||
Kcnk18 | NP_997144.1 | Ion_trans_2 | <111..166 | CDD:285168 | 25/55 (45%) |
Interaction with calcineurin | 210..215 | 0/4 (0%) | |||
Interaction with YWHAH. /evidence=ECO:0000269|PubMed:18397886 | 261..266 | 0/4 (0%) | |||
Ion_trans_2 | 300..376 | CDD:285168 | 27/75 (36%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C167845577 | |
Domainoid | 1 | 1.000 | 68 | 1.000 | Domainoid score | I9706 |
eggNOG | 1 | 0.900 | - | - | E1_KOG1418 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000030 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR11003 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
6 | 5.840 |