DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43155 and kcnd3

DIOPT Version :10

Sequence 1:NP_572720.2 Gene:CG43155 / 32092 FlyBaseID:FBgn0262685 Length:411 Species:Drosophila melanogaster
Sequence 2:XP_005167059.1 Gene:kcnd3 / 327415 ZFINID:ZDB-GENE-030131-5626 Length:650 Species:Danio rerio


Alignment Length:59 Identity:17/59 - (28%)
Similarity:37/59 - (62%) Gaps:6/59 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 SILQAVFFSSTVLTTIGYGNIVPVTTGGRVF-CIC----FALIGIPFTLTVIADWGRLF 214
            ||..:.:::...:||:|||::||.|..|::| .||    ..:|.:|..: :::::.|::
Zfish   352 SIPASFWYTIVTMTTLGYGDMVPKTIAGKIFGSICSLSGVLVIALPVPV-IVSNFSRIY 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43155NP_572720.2 Ion_trans_2 143..214 CDD:462301 17/57 (30%)
Ion_trans_2 <267..319 CDD:462301
kcnd3XP_005167059.1 BTB_POZ_KCND3 6..143 CDD:349726
Ion_trans 181..411 CDD:459842 17/59 (29%)
DUF3399 481..556 CDD:463381
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.