DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43155 and Kcng2

DIOPT Version :10

Sequence 1:NP_572720.2 Gene:CG43155 / 32092 FlyBaseID:FBgn0262685 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_001100842.1 Gene:Kcng2 / 307234 RGDID:1309521 Length:480 Species:Rattus norvegicus


Alignment Length:90 Identity:25/90 - (27%)
Similarity:48/90 - (53%) Gaps:7/90 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   248 FLGVYLAAGAGLLLLWE-------DDWTFFDGFYFCFITMTTIGFGDLVPKKPNYMLLCTLYILI 305
            ||.|.:|..|.|:.|.|       |..:....:::..|:|||:|:||:||:.....::....||.
  Rat   341 FLCVAMALFAPLVHLAERELGAHRDFSSVPASYWWAVISMTTVGYGDMVPRSLPGQVVALSSILS 405

  Fly   306 GLALTSTIIELVRRQYATSWAKLQE 330
            |:.|.:..:..:...::.|:::|:|
  Rat   406 GILLMAFPVTSIFHTFSRSYSELKE 430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43155NP_572720.2 Ion_trans_2 143..214 CDD:462301
Ion_trans_2 <267..319 CDD:462301 13/51 (25%)
Kcng2NP_001100842.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..25
BTB_POZ_Kv6_KCNG 33..127 CDD:349691
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 144..167
Ion_trans 190..429 CDD:459842 23/87 (26%)
Selectivity filter. /evidence=ECO:0000250|UniProtKB:P63142 382..387 2/4 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 429..480 1/2 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.