DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43155 and Kcna10

DIOPT Version :10

Sequence 1:NP_572720.2 Gene:CG43155 / 32092 FlyBaseID:FBgn0262685 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_001074609.1 Gene:Kcna10 / 242151 MGIID:3037820 Length:511 Species:Mus musculus


Alignment Length:154 Identity:34/154 - (22%)
Similarity:66/154 - (42%) Gaps:27/154 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   230 KFTNFIGKTWFYAILAVG------FLGVYLAAGAGLLLLWEDDWTFF----DGFYFCFITMTTIG 284
            |....:|:|...::..:|      |:||.|.:.|......::..:.|    |||::..:||||:|
Mouse   359 KGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEVDEPESHFSSIPDGFWWAVVTMTTVG 423

  Fly   285 FGDLVPKKPNYMLLCTLYILIGLALTSTIIELVRRQY------ATSWAKLQELSGPMAETLRRLG 343
            :||:.|..|...::.||..:.|:...:..:.::...:      .|...:...:.|.:.:.|..:|
Mouse   424 YGDMCPTTPGGKIVGTLCAIAGVLTIALPVPVIVSNFNYFYHRETENEEKPNIPGELDKILNSMG 488

  Fly   344 ETAGTGLDYTALQKVLTVSMPKWN 367
            ...|:           |.|:.|.|
Mouse   489 SRMGS-----------TESLNKTN 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43155NP_572720.2 Ion_trans_2 143..214 CDD:462301
Ion_trans_2 <267..319 CDD:462301 16/55 (29%)
Kcna10NP_001074609.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 25..44
BTB_POZ 86..212 CDD:453885
Ion_trans 262..467 CDD:459842 25/107 (23%)
Selectivity filter. /evidence=ECO:0000250|UniProtKB:P63142 421..426 2/4 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 489..511 5/24 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.