DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43155 and Kcnk15

DIOPT Version :9

Sequence 1:NP_572720.2 Gene:CG43155 / 32092 FlyBaseID:FBgn0262685 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_001025463.1 Gene:Kcnk15 / 241769 MGIID:2675209 Length:343 Species:Mus musculus


Alignment Length:305 Identity:91/305 - (29%)
Similarity:127/305 - (41%) Gaps:61/305 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 GGLAKGTAGGRRSTACWQSMKWKSALNHIGLLVSLSIYCGVGGLIFRHLERPAEVERLSHLKDIV 102
            |....||..||      .:|:.:||.....:|..|| |..||..:|..||..||..|    :.::
Mouse     7 GRTETGTRSGR------AAMRKQSARTAALILCILS-YLLVGAAVFDALESEAERSR----QRLL 60

  Fly   103 KTHRERFLHTILNNTEVHNLDELLSFELAKYEAAVQQAAEGGLLIVADKDFPEPYERWSILQAVF 167
            ...|..|......:.:.:...|.|:.:...:.|..|                     |....:.:
Mouse    61 ARKRGEFRRKYRFSADDYRELERLALQAEPHRAGRQ---------------------WRFAGSFY 104

  Fly   168 FSSTVLTTIGYGNIVPVTTGGRVFCICFALIGIPFTLTVIADWGR--------LFATAVSVFGKH 224
            |:.||:||||||:..|.|..|:|||:.:||:|||.||......|.        |..||....|..
Mouse   105 FAITVITTIGYGHAAPGTDSGKVFCMFYALLGIPLTLVTFQSLGERLNTLVRCLLLTAKRCLGLR 169

  Fly   225 MPTKPKFTNFI--GKTWFYAILAVGFLGVYLAAGAGLLLLWEDDWTFFDGFYFCFITMTTIGFGD 287
            .| .....|.:  |.....|.||:|.:......|          ||||..:|:||||:|||||||
Mouse   170 RP-HVSAENMVVAGLLLCAATLALGAIAFAHFEG----------WTFFHAYYYCFITLTTIGFGD 223

  Fly   288 LV--------PKKPNYMLLCTLYILIGLALTSTIIELVRRQYATS 324
            .|        .:||.|:....||||:||.:....:.||..::..|
Mouse   224 FVALQRDEALQRKPPYVAFSFLYILLGLTVIGAFLNLVVLRFLAS 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43155NP_572720.2 Ion_trans_2 <157..214 CDD:285168 24/64 (38%)
Ion_trans <240..314 CDD:278921 31/81 (38%)
Ion_trans_2 <266..319 CDD:285168 28/60 (47%)
Kcnk15NP_001025463.1 Ion_trans_2 <96..151 CDD:285168 25/75 (33%)
Ion_trans_2 195..262 CDD:285168 28/76 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X19
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.