DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43155 and Kcnk9

DIOPT Version :9

Sequence 1:NP_572720.2 Gene:CG43155 / 32092 FlyBaseID:FBgn0262685 Length:411 Species:Drosophila melanogaster
Sequence 2:XP_006520831.1 Gene:Kcnk9 / 223604 MGIID:3521816 Length:604 Species:Mus musculus


Alignment Length:378 Identity:105/378 - (27%)
Similarity:158/378 - (41%) Gaps:82/378 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VKEYDSQDEASTEL---------LEKLK-HLDRRVDAAEGGGL--------AKGTAGGRRSTACW 54
            |:|.|...| .||:         ..:|: .|.||      |||        ::|......|.:.:
Mouse   143 VRESDDAQE-ETEISNISCGICCYHRLQLRLHRR------GGLVSAALHWDSRGLVQLPFSISFF 200

  Fly    55 QSMKWKSALNHIGLLVSLSIYCGVGGLIFRHLERPAEVERLSHLKDIVKTHRERFLHTILNNTEV 119
            .:|| :..:..:.|:.....|..||..:|..||...|:.....||  .:..|.|..:.|  :::.
Mouse   201 AAMK-RQNVRTLSLIACTFTYLLVGAAVFDALESDHEMREEEKLK--AEEVRLRGKYNI--SSDD 260

  Fly   120 HNLDELLSFELAKYEAAVQQAAEGGLLIVADKDFPEPYERWSILQAVFFSSTVLTTIGYGNIVPV 184
            :...||:..:...:.|.||                     |....:.:|:.||:||||||:..|.
Mouse   261 YQQLELVILQSEPHRAGVQ---------------------WKFAGSFYFAITVITTIGYGHAAPG 304

  Fly   185 TTGGRVFCICFALIGIPFTLTVIADWGRLFATAVSVFGKHMP-------TKPKFTNFIGKTWFYA 242
            |..|:.||:.:|::|||.||.:....|....|.|....|.:.       |:....|.:       
Mouse   305 TDAGKAFCMFYAVLGIPLTLVMFQSLGERMNTFVRYLLKRIKKCCGMRNTEVSMENMV------- 362

  Fly   243 ILAVGFLGVY--LAAGAGLLLLWEDDWTFFDGFYFCFITMTTIGFGDLV--------PKKPNYML 297
              .|||....  |..||......| ||:||..:|:||||:|||||||.|        .:||.|:.
Mouse   363 --TVGFFSCMGTLCLGAAAFSQCE-DWSFFHAYYYCFITLTTIGFGDFVALQAKGALQRKPFYVA 424

  Fly   298 LCTLYILIGLALTSTIIELVRRQYATSWAKLQELSGPMAETL----RRLGETA 346
            ...:|||:||.:....:.||..::.|.....:.|.|.:||.|    ||:...|
Mouse   425 FSFMYILVGLTVIGAFLNLVVLRFLTMNTDEELLEGEVAEILAGNPRRVSVRA 477

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43155NP_572720.2 Ion_trans_2 <157..214 CDD:285168 22/56 (39%)
Ion_trans <240..314 CDD:278921 32/83 (39%)
Ion_trans_2 <266..319 CDD:285168 27/60 (45%)
Kcnk9XP_006520831.1 Ion_trans_2 <279..334 CDD:400301 23/75 (31%)
Ion_trans_2 372..445 CDD:400301 30/73 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X19
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.