DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43155 and twk-12

DIOPT Version :9

Sequence 1:NP_572720.2 Gene:CG43155 / 32092 FlyBaseID:FBgn0262685 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_505731.3 Gene:twk-12 / 192074 WormBaseID:WBGene00006667 Length:684 Species:Caenorhabditis elegans


Alignment Length:319 Identity:85/319 - (26%)
Similarity:139/319 - (43%) Gaps:61/319 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 LSIYCGVGGLIFRHLERPAEVERLS---HLKDIVKTH-RERFLH----TILNNTEVHNLDELLSF 128
            |..|...|..:||..|..|:::|.|   :..::|:.. .||::.    .:|.|      |..|.|
 Worm    25 LIAYTAFGAWLFRTYELQADIKRRSVFGNTTNLVRRQLAERWIEMHKDAVLRN------DSALRF 83

  Fly   129 ELAKYEAAVQQAAEGGL--LIVAD--KDFPEPYERWSILQAVFFSSTVLTTIGYGNIVPVTTGGR 189
            ..|      .:|.|..|  |.::|  :|..|. ..|:...|:|::..:.||||||.....|..||
 Worm    84 RRA------AEAVEWLLDELNLSDHIRDLSEE-TPWTWTGAMFYAGQLYTTIGYGYPTTKTDEGR 141

  Fly   190 VFCICFALIGIPFTLTVIADWGRLFATAVSVFGKH----------MPTK----------PKFTNF 234
            :..|.:||.|||..|..:...|:..:..:..:.|.          :||:          |:....
 Worm   142 ICTIFYALFGIPCFLMYLKSIGKTLSKKMKKYYKKLRRSRVGRILLPTRVTAMKDGFEDPEAAEE 206

  Fly   235 IGKTWFYAILAVGFLGVYLAAGAGLLLLWEDDWTFFDGFYFCFITMTTIGFGDLVPKKPNYMLLC 299
            ..|..|...:|:..|.:::...|.:..:|||.|.|....||..::::|:|.||::.:.|:.|:..
 Worm   207 RKKKPFPIPIAIIMLIIWICFSASMFCIWEDTWVFSSAVYFFIVSISTVGLGDMLFRTPDMMVFN 271

  Fly   300 TLYILIGLALTSTIIELVRRQYATSW---------AKLQELS------GPMAETLRRLG 343
            .|.||:||||.|...||:..:.| .|         .|:|:::      .|..|....||
 Worm   272 FLLILVGLALLSMCFELITDRVA-KWKQKRFDEHIKKVQKMAFQVFEKDPFIEEAPPLG 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43155NP_572720.2 Ion_trans_2 <157..214 CDD:285168 20/56 (36%)
Ion_trans <240..314 CDD:278921 25/73 (34%)
Ion_trans_2 <266..319 CDD:285168 20/52 (38%)
twk-12NP_505731.3 Ion_trans_2 92..167 CDD:285168 25/75 (33%)
Ion_trans_2 226..>272 CDD:285168 14/45 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.