DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43155 and twk-6

DIOPT Version :9

Sequence 1:NP_572720.2 Gene:CG43155 / 32092 FlyBaseID:FBgn0262685 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_497973.1 Gene:twk-6 / 192070 WormBaseID:WBGene00006661 Length:347 Species:Caenorhabditis elegans


Alignment Length:264 Identity:63/264 - (23%)
Similarity:107/264 - (40%) Gaps:58/264 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 QAVFFSSTVLTTIGYGNIVPVTTGGRVFCICFALIGIPFTLTVIADWGRLFATAVSVFGKHMPTK 228
            :|:|||.|:.:|:|||::.|.:|.||...|.::|:.||..:....::|...|..:.|....    
 Worm   111 KAIFFSWTLYSTVGYGSLYPHSTLGRYLTIFYSLLMIPVFIAFKFEFGTFLAHFLVVVSNR---- 171

  Fly   229 PKFTNFIGKTWFYAILA----------------VGFLGVYLAAGAGLL---LLWE--DDWTFFDG 272
               |....|..:|.:..                :.||...|.....||   .|:.  ::.::...
 Worm   172 ---TRLAVKKAYYKLSQNPENAETPSNSLQHDYLIFLSSLLLCSISLLSSSALFSSIENISYLSS 233

  Fly   273 FYFCFITMTTIGFGDLVPKK----PNYMLLCTLYILIGLALTSTIIELVRRQYATSWAKLQELSG 333
            .||..|||..||.||:||..    ..|   |.|: ||...|::.|....:       |:::....
 Worm   234 VYFGIITMFLIGIGDIVPTNLVWFSGY---CMLF-LISDVLSNQIFYFCQ-------ARVRYFFH 287

  Fly   334 PMAETLRRLGETAGTGLDYTALQKVLTVSMPKWNSKKNEHSPDIAALEAITNAILKEVKEAQNNK 398
            .:|..:..|.|      :....|...|||:        :|.|.|.: :.:.:.:|...||..:|.
 Worm   288 ILARKILLLRE------EDDGFQLETTVSL--------QHIPIINS-QCMPSLVLDCEKEELDND 337

  Fly   399 PKVL 402
            .|::
 Worm   338 EKLI 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43155NP_572720.2 Ion_trans_2 <157..214 CDD:285168 18/49 (37%)
Ion_trans <240..314 CDD:278921 24/98 (24%)
Ion_trans_2 <266..319 CDD:285168 18/56 (32%)
twk-6NP_497973.1 Ion_trans_2 <109..163 CDD:285168 18/51 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160163760
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.