DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43155 and twk-45

DIOPT Version :9

Sequence 1:NP_572720.2 Gene:CG43155 / 32092 FlyBaseID:FBgn0262685 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_001122742.2 Gene:twk-45 / 190614 WormBaseID:WBGene00006695 Length:508 Species:Caenorhabditis elegans


Alignment Length:412 Identity:108/412 - (26%)
Similarity:166/412 - (40%) Gaps:99/412 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 RRSTACWQSMKW------KSALNHIGLLVSLSIYCGVGGLIFRHLERPAEVERLSH-LK------ 99
            ||....| ...|      |..:.||.|:..|:.|..:||.:|:.||.|.|:|.|.. ||      
 Worm    64 RREKITW-FFAWLAYYHHKFGIRHITLISILAAYICLGGFLFQKLESPREIEELQETLKSMNEII 127

  Fly   100 -----DIVK----THRE----------RFLHTILNNTEVHNLDELLSFELAKYEAAVQQAAEGGL 145
                 ||:|    |:.|          |..|.||..||            .|:..:....:|.  
 Worm   128 KNETMDIIKITLTTNGEDRNQKLGDLLRAYHRILLETE------------GKFHGSAWHKSEN-- 178

  Fly   146 LIVADKDFPEPYERWSILQAVFFSSTVLTTIGYGNIVPVTTGGRVFCICFALIGIPFTLTVIAD- 209
               .|.:.     .|....|.|:|.|:.:|||||.|...|..|:...:.:|.||:|..|.|:.| 
 Worm   179 ---LDMNL-----MWYFSSATFYSMTLFSTIGYGTITCQTFWGKTVSMVYASIGLPIMLLVLGDI 235

  Fly   210 --WGRLFATAVSVF---------GKHMPTKPKFTNFIGKTWFYAILAVGFLGVYLAAGAGLLLLW 263
              |.:...|...:|         .:.:..|.|.|  :...|    ||:..:..|:......:||:
 Worm   236 GVWFQKVMTNAYIFVMLKYKSLRKQSIEIKRKET--LLPMW----LAMLVVFTYIIICTLTILLF 294

  Fly   264 EDD------WTFFDGFYFCFITMTTIGFGDLVPKKPNYMLLCTLYILIGLALTSTIIELVRRQYA 322
            :|:      ..|||.|||.||::||||.||::|....|.....|..|:||||.|.:...:   |:
 Worm   295 DDNEGDEPGINFFDAFYFTFISLTTIGLGDVMPYNIQYSPFLPLAFLLGLALISIVNTSI---YS 356

  Fly   323 TSWAKLQELSGPMAETLRRLGETAGTGLDYTALQ------KVLTVSMPKWNSKKNEHSPDIAALE 381
            |.:.....|...:.:.|.|:..:...|..|...|      ::|..:.|.        ||..:.:.
 Worm   357 TLYQSFYNLIYSLEDQLDRIHNSRRRGAGYRVFQDMESTFQMLVCTFPP--------SPAHSRIR 413

  Fly   382 --AITNAILKEVKEAQNNKPKV 401
              ::.....:|.|: ::.:|||
 Worm   414 FASLIRDSFREAKK-ESAQPKV 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43155NP_572720.2 Ion_trans_2 <157..214 CDD:285168 21/59 (36%)
Ion_trans <240..314 CDD:278921 29/79 (37%)
Ion_trans_2 <266..319 CDD:285168 23/58 (40%)
twk-45NP_001122742.2 Ion_trans_2 <185..241 CDD:285168 21/55 (38%)
Ion_trans_2 278..354 CDD:285168 27/75 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160163737
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D542195at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X19
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.