DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43155 and kvs-4

DIOPT Version :9

Sequence 1:NP_572720.2 Gene:CG43155 / 32092 FlyBaseID:FBgn0262685 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_001367099.1 Gene:kvs-4 / 190011 WormBaseID:WBGene00012967 Length:539 Species:Caenorhabditis elegans


Alignment Length:182 Identity:42/182 - (23%)
Similarity:73/182 - (40%) Gaps:45/182 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 QSMKWKSALNHIGLLVSLSIYCGVGGLIFRHLERPAEVERLSHLKDIVKTHRERFLHTILNNTEV 119
            :|..::..||.|.||..|.....:..|||     ....|:|..||.       .||  ::....|
 Worm   340 RSKTFRQLLNIIDLLAILPFIIEMLLLIF-----GISTEQLRDLKG-------AFL--VIRILRV 390

  Fly   120 HNLDELLSFELAKYEAAVQQAAE-----------------------GGLLIVADKDFPEPYERW- 160
            ..:..:|  :|.:|.:.:|...:                       ..|:...:||  ||..:: 
 Worm   391 LRVIRVL--KLGRYSSGLQMFGKTLKASFRQLGMMAMVVMTGVIFFSTLVYFLEKD--EPASKFH 451

  Fly   161 SILQAVFFSSTVLTTIGYGNIVPVTTGGRVF---CICFALIGIPFTLTVIAD 209
            ||..|.::....:||:|||::.|||..|::.   .|...::.:...:|:|.|
 Worm   452 SIPAACWWCIVTMTTVGYGDLTPVTVPGKLVATGAIACGVLVLALPITIIVD 503

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43155NP_572720.2 Ion_trans_2 <157..214 CDD:285168 16/57 (28%)
Ion_trans <240..314 CDD:278921
Ion_trans_2 <266..319 CDD:285168
kvs-4NP_001367099.1 BTB_POZ_Kv 121..208 CDD:349626
Ion_trans 265..513 CDD:395416 42/182 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D774951at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X19
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.