DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43155 and twk-37

DIOPT Version :9

Sequence 1:NP_572720.2 Gene:CG43155 / 32092 FlyBaseID:FBgn0262685 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_491810.2 Gene:twk-37 / 183583 WormBaseID:WBGene00006689 Length:382 Species:Caenorhabditis elegans


Alignment Length:344 Identity:84/344 - (24%)
Similarity:151/344 - (43%) Gaps:49/344 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 MKKVTVKEYDSQDEASTELLEK---LKHLDRRVDAAEGGGLAKGTAGGRRSTACWQSMKWKSALN 64
            :.|...::.:.....:..|:.|   ||.::|           |..|...:.|.....::.....|
 Worm    41 INKFIKRQMEKSSPETQHLVRKQSILKFVER-----------KSRAERPKPTKLRTILRKIRKFN 94

  Fly    65 HIGLLVSLSIYCGVGGLIFRHLERPAEVERLSHLKDIVKTHRERFLHTILNNTEVHNLDELLSFE 129
            .|...|.|..|...|.|:|..:|..:::    ::.:..:..|::.:| |.|:.:.....:|...:
 Worm    95 TIIAFVVLVAYIIGGALLFWQIESRSDM----NINEFKRNIRQKSIH-IYNSMKGSKCGKLKKAD 154

  Fly   130 LAKYEAAVQQAAEGGLLIVADKDFPEPYERWSILQAVFFSSTVLTTIGYGNIVPVTTGGRVFCIC 194
            .......:::..:   |:.|... |:..|.:  |..:.:..|.:||||||.:|..|..|::..:.
 Worm   155 NELNNNCIKEIFD---LLYASNP-PKHIEEF--LDGLAYVITCITTIGYGELVCHTIAGKLVTVA 213

  Fly   195 FALIGIPFTLTVIADWG-----------RLFATAVSVFGKHMPTKPKFTNFIGKTWFYAILAVGF 248
            :.:|||..||.|:.:.|           ::||..|...||   ...|:...:.|.:   ||.|.|
 Worm   214 YGIIGIALTLYVLRNNGKITLKICNLTLKIFAICVRKCGK---KSAKYKMTVLKAF---ILLVTF 272

  Fly   249 LGVYLAAGAGLLLLWEDDWTFFDGFYFCFITMTTIGFGDLVPK-KPNYMLLCTLYILIGLALTST 312
            .|.    ||..:.::| ::.|:|..||.|.|.:||||||.||. ..:..::|.|: .|.|:|.|.
 Worm   273 WGF----GALAIAVYE-EFVFYDALYFSFSTFSTIGFGDFVPSGHISGTIICVLH-FIDLSLISM 331

  Fly   313 IIELVRRQYATSWAKLQEL 331
            ::.||.......:.::.||
 Worm   332 VLVLVHHSMENRFMRVLEL 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43155NP_572720.2 Ion_trans_2 <157..214 CDD:285168 19/67 (28%)
Ion_trans <240..314 CDD:278921 28/74 (38%)
Ion_trans_2 <266..319 CDD:285168 22/53 (42%)
twk-37NP_491810.2 Ion_trans_2 <181..235 CDD:285168 18/55 (33%)
Ion_trans_2 267..336 CDD:285168 28/74 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X19
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.870

Return to query results.
Submit another query.