DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43155 and B0310.1

DIOPT Version :9

Sequence 1:NP_572720.2 Gene:CG43155 / 32092 FlyBaseID:FBgn0262685 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_001370323.1 Gene:B0310.1 / 181922 WormBaseID:WBGene00015137 Length:292 Species:Caenorhabditis elegans


Alignment Length:330 Identity:77/330 - (23%)
Similarity:131/330 - (39%) Gaps:92/330 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 VGGLIFRHLERPAEVERLSHLKDIVKTHRER-------FLHTILNNTEVHNLDELLSFELAKYEA 135
            :|.::|..|..|| |::..:...|.:...:|       :..||.|..:  :..||...:|..||.
 Worm    29 IGMILFPALCTPA-VKQDDNEAGIFRLDAKRSDLLNVLWAETITNGED--DWSELADQKLELYEK 90

  Fly   136 AVQQAAEGGL-LIVADKDFPEPYERWSILQAVFFSSTVLTTIGYGNIVPVTTGGRVFCICFALIG 199
            |:.|  ..|: |..:||.|....::         |..:.||||..::...||.|::..:.:||||
 Worm    91 ALLQ--HYGIDLDKSDKSFASGLQK---------SFAISTTIGPLDVDDFTTLGKLIAVLYALIG 144

  Fly   200 IPFTLTVIADWGRLFATAVSVFGKHMPTKPKFTNFIGKT-WFYAILAVGFLGVYLAAGAGLLLLW 263
            .|..||||...|:: .|:|               :.|.| |...|       ||:...|.:..:.
 Worm   145 TPLFLTVIGQLGKM-VTSV---------------WQGTTLWIVTI-------VYIFISAVIYDIV 186

  Fly   264 E---DDWTFFDGFYFCFITMTTIG-----FGDLVPKKPNYMLLCTLYILIGLALTSTIIELVRRQ 320
            |   ||..|.:..:..|:..||:|     |..::|    |.:     :::||||.:.:       
 Worm   187 EGGSDDVPFIEAIFSIFLQFTTVGEVDNEFHGVLP----YCI-----VVLGLALITAL------- 235

  Fly   321 YATSWAKLQELSGPMAETLRRLGETAGTGLDYTALQKVLTVSMPKWNSKKNEHSPDIAALEAITN 385
            |......::....|...:..||   .|              ::.:|..:|:|....|     :|:
 Worm   236 YQEMQHNIERFIHPFEYSFNRL---CG--------------NVERWAGEKSEDKKSI-----VTS 278

  Fly   386 AILKE 390
            .|.:|
 Worm   279 RIEEE 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43155NP_572720.2 Ion_trans_2 <157..214 CDD:285168 18/56 (32%)
Ion_trans <240..314 CDD:278921 19/81 (23%)
Ion_trans_2 <266..319 CDD:285168 13/57 (23%)
B0310.1NP_001370323.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.