DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43155 and twk-18

DIOPT Version :9

Sequence 1:NP_572720.2 Gene:CG43155 / 32092 FlyBaseID:FBgn0262685 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_001379714.1 Gene:twk-18 / 181139 WormBaseID:WBGene00006672 Length:461 Species:Caenorhabditis elegans


Alignment Length:326 Identity:91/326 - (27%)
Similarity:141/326 - (43%) Gaps:64/326 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 LVSLSIYCGVGGLIFRHLERPAEVERLSHLKDIVKTHRER---FLHTI--LNNTEVHNLDELLSF 128
            |:.|..|..:|..||..:|...|.|.|      ::..:||   ...|:  :|..::.....|::.
 Worm    25 LIILVAYTLLGAWIFWMIEGENEREML------IEQQKERDELIRRTVYKINQLQIKRQRRLMTA 83

  Fly   129 ELAKYE--AAVQQAAEGGLLIV---ADKDFPEPYERWSILQAVFFSSTVLTTIGYGNIVPVTTGG 188
            | .:|.  |.|....:..|.||   .|||.     .|:.|.::|:..||.||||||||||.|..|
 Worm    84 E-EEYNRTAKVLTTFQETLGIVPADMDKDI-----HWTFLGSIFYCMTVYTTIGYGNIVPGTGWG 142

  Fly   189 RVFCICFALIGIPFTLTVIADWGRLFA-----------TAVSVFGKHM----------------- 225
            |...|.:|.||||.|:..:...|.|||           .:..|..|.:                 
 Worm   143 RFATILYAFIGIPLTVLSLYCLGSLFAKGCKMLWRFFLKSTRVVSKDLSNKISEAADNIEEGTTA 207

  Fly   226 --PTKPKFTNFIGKTWFYAILAVGFLGVYLAAGAGLLLLWEDDWTFFDGFYFCFITMTTIGFGDL 288
              |:..|..|.......:.|..:..:.|.......:|..:.::|.|....||..|:.|||||||:
 Worm   208 ITPSAEKTENNDDDLLSFPISGLLLITVIWVIFCAVLFTFLEEWDFGTSLYFTLISFTTIGFGDI 272

  Fly   289 VPKKPNYMLLCTLYILIGLALTSTIIELVRRQYATSWAKLQELSGPMAETL-----RRLGETAGT 348
            :|...::|.:..:.:||||:|.||::.|:::|       ::.|:..|.:.:     |.|.|....
 Worm   273 LPSDYDFMPIVGVLLLIGLSLVSTVMTLIQQQ-------IEALASGMKDNIDQEYARALNEARED 330

  Fly   349 G 349
            |
 Worm   331 G 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43155NP_572720.2 Ion_trans_2 <157..214 CDD:285168 26/56 (46%)
Ion_trans <240..314 CDD:278921 24/73 (33%)
Ion_trans_2 <266..319 CDD:285168 22/52 (42%)
twk-18NP_001379714.1 Ion_trans_2 <114..170 CDD:400301 28/55 (51%)
Ion_trans_2 232..306 CDD:400301 25/80 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D542195at33208
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.