DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43155 and twk-17

DIOPT Version :9

Sequence 1:NP_572720.2 Gene:CG43155 / 32092 FlyBaseID:FBgn0262685 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_001024464.1 Gene:twk-17 / 181024 WormBaseID:WBGene00006671 Length:576 Species:Caenorhabditis elegans


Alignment Length:409 Identity:95/409 - (23%)
Similarity:150/409 - (36%) Gaps:97/409 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 KSALNHIGLLVSLSIYCGVGGLIFRHLERPAEVE----RLSHLKDIVKTHRERFLHTILNN---- 116
            |..|.|:||.|.|..|..:|..:|..||...|:|    ::.|:.||........: .:.||    
 Worm   138 KILLPHVGLNVLLLSYIAMGATVFIWLEADHELEGRKAKVKHVFDIYSQIMNETI-ALTNNQSDQ 201

  Fly   117 -TEVHNLDELLSFELAKYEAAVQQAAEGGLLIVADKDFPEPYERWSILQAVFFSSTVLTTIGYGN 180
             |.|..:..||. .|::......:..:...|...::|  ....||:...|..::.||:|:.||.:
 Worm   202 ATIVSRMRPLLE-SLSRAHEYDDKFTDTNQLWTGEQD--GMTTRWTFAAATLYALTVITSTGYDH 263

  Fly   181 IVPVTTGGRVFCICFALIGIPFTLTVIADWG------------------RLFATAVSVFGKH--- 224
            :.|.|..||:|.:.|.|||||......||.|                  ::.|..|.:...|   
 Worm   264 VTPATDPGRIFTVFFGLIGIPLMFITAADIGKFLSEIVIRTYAKLLAMWKMIANLVELVRTHLFD 328

  Fly   225 -----------------------------------MPTKPKFTNFIGKTWFYAILAVGFLGVYLA 254
                                               :|....||..||               |..
 Worm   329 TDVDSIDSMELKKSKKRNASSLDDEECEDEEDRLQLPIASYFTLIIG---------------YCC 378

  Fly   255 AGAGLLLLWEDD--WTFFDGFYFCFITMTTIGFGDLVPKKPNYMLLCTLYILIGLALTSTIIELV 317
            .|:.|...:|..  |:|..|.:|.|.|:||||.|::..::..|:.|...|::||||:.:..::|.
 Worm   379 VGSLLFNTFEKGPVWSFIHGVFFSFNTITTIGLGNIRVQQHYYLALAVSYVIIGLAVITASLDLC 443

  Fly   318 RRQYATSWAKLQELSGPMAETLRRLGETAGTGLDYTALQKVLTVSMPKWNSKKNEHSPDIAALEA 382
            ......::.||......:....|..   |....|.....:::..      .||...|.|...||.
 Worm   444 SSTLKRTFTKLHYFGRKIRGARRGF---ANMSDDIREAMRIIAA------LKKTRPSKDRITLED 499

  Fly   383 ITNAILKEVKEAQNNKPKV 401
            :...:  ||:|....:|.|
 Worm   500 LKRFL--EVQEHLLRQPYV 516

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43155NP_572720.2 Ion_trans_2 <157..214 CDD:285168 22/74 (30%)
Ion_trans <240..314 CDD:278921 22/75 (29%)
Ion_trans_2 <266..319 CDD:285168 19/54 (35%)
twk-17NP_001024464.1 Ion_trans_2 <242..299 CDD:285168 22/56 (39%)
Ion_trans_2 371..449 CDD:285168 26/92 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.