DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43155 and twk-16

DIOPT Version :9

Sequence 1:NP_572720.2 Gene:CG43155 / 32092 FlyBaseID:FBgn0262685 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_508526.2 Gene:twk-16 / 180594 WormBaseID:WBGene00006670 Length:555 Species:Caenorhabditis elegans


Alignment Length:346 Identity:97/346 - (28%)
Similarity:158/346 - (45%) Gaps:81/346 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 HIGLLVSLSIYCGVGGLIFRHLERPAEVERLSHLKDIVKTHR----ERFLHTI--LNNTEVHNLD 123
            |..||:.:.:|..:||.||..:|..|..|    :|...:.:|    .:.||:|  .::.:.|.  
 Worm    26 HCSLLMLVLLYSFLGGFIFDRIETNAHAE----MKRNERINRTACVSQILHSIHRWSHNQTHK-- 84

  Fly   124 ELLSFELAKYEAAVQQAAEGGLLIVADKDFPEPYER--WSILQAVFFSSTVLTTIGYGNIVPVTT 186
                         ||.|.:     :||...||..||  |:.:.|..:...::||:||..|.|:|.
 Worm    85 -------------VQYAED-----IADCFEPEKDERSEWNFVTATLYGFGIVTTLGYNRIAPITY 131

  Fly   187 GGRVFCICFALIGIPFTLTVIADWGRL---FA----------------TAVSVFGK-HMPTKPKF 231
            .||:|||.:.:.|||.|:.:||:.|:.   ||                :..|:.|| :..:..:.
 Worm   132 TGRMFCIVYGICGIPVTMIIIANVGQYLNNFAGDSRRKIEAYRQQRRMSKASLAGKIYKESSIQV 196

  Fly   232 TNFIGKTWFYAILAVGFLGVYLAAGAGLLLLWEDDWTFFDGFYFCFITMTTIGFGDLVPKKPNYM 296
            |:.       |:|.| || :|:|.||.||.|...:..||:|.||.|:.:|.|.||.|||.:...:
 Worm   197 TSL-------ALLCV-FL-IYVAVGALLLPLLNGELDFFNGLYFNFLCLTAIDFGQLVPIRVELL 252

  Fly   297 LLCTLYILIGLALTSTIIELVRRQYATS---WAKLQELSG-----------PMAETLRRLGETAG 347
            .:..||:.||||:|:..|. :..:|...   |.|..:.:.           .:.:.|..:|:..|
 Worm   253 PITFLYVCIGLAITTIAIN-IGSEYMKKLHYWGKKMKNAAQTRIWFGGKTLKVRDLLHAVGKKCG 316

  Fly   348 TG---LDYTALQKVL--TVSM 363
            ..   :|...|:.|:  |::|
 Worm   317 VEPGMIDALDLENVVERTIAM 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43155NP_572720.2 Ion_trans_2 <157..214 CDD:285168 23/61 (38%)
Ion_trans <240..314 CDD:278921 32/73 (44%)
Ion_trans_2 <266..319 CDD:285168 21/52 (40%)
twk-16NP_508526.2 Ion_trans_2 <102..159 CDD:285168 22/56 (39%)
Ion_trans_2 204..279 CDD:285168 32/77 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D774951at2759
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.880

Return to query results.
Submit another query.