DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43155 and twk-46

DIOPT Version :9

Sequence 1:NP_572720.2 Gene:CG43155 / 32092 FlyBaseID:FBgn0262685 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_741678.1 Gene:twk-46 / 180252 WormBaseID:WBGene00006696 Length:319 Species:Caenorhabditis elegans


Alignment Length:311 Identity:81/311 - (26%)
Similarity:149/311 - (47%) Gaps:60/311 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 TACWQSMKWKSALNHIGLLVSLS---IYCGVGGLIFRHLERPAE-VERLSHLKDIVKTHRERFLH 111
            |.....|:.:...:::.:||.|.   :|..||.::|..:|.|.| :||.::| |.....|:|.:.
 Worm    10 TKVLNGMEGRMRESNMRILVGLGVAVVYLFVGAIVFVRIEYPLEKIEREAYL-DYQNQWRDRLIQ 73

  Fly   112 TILNNTEVHNLDELLSFELAKYEAAVQQAAEGGLLIVADKDF-PEPYERWSILQAVFFSSTVLTT 175
            ..::.:|:   |:|.        ..:::||..|:.:  |::. .:|  .|:..||.||:.|:::|
 Worm    74 LDIDESEI---DKLF--------LNIREAALNGIWM--DRNLTSDP--NWTFGQAFFFAGTLIST 123

  Fly   176 IGYGNIVPVTTGGRVFCICFALIGIPFTLTVIADWGRLFATAVSVFGKHMPTKPKFTNF----IG 236
            :|||.:.|.|..|::|.|.:.:||||.||.:::          ::..:......|....    :|
 Worm   124 VGYGRVSPRTEYGKLFTILYCVIGIPLTLALLS----------AIVARMREPSHKLRGLLNQRLG 178

  Fly   237 KTWFYAILAVGFLGVYLAAGAGLLLL------W-----EDDWTFFDGFYFCFITMTTIGFGDLVP 290
            ..:....:.:..:||..|:   |||.      |     |.||::.|.||:||:::||||.||..|
 Worm   179 HLFTVNHIQLIHVGVVFAS---LLLFVFAIPAWVFSSIETDWSYLDAFYYCFVSLTTIGLGDFEP 240

  Fly   291 -KKPN------YMLLCTLYILIGLA----LTSTIIELVRRQYATSWAKLQE 330
             ..||      |.:..|:|::.||.    ..:|:.::.:....:.:.|..|
 Worm   241 GDDPNQSFRGLYKIGATVYLMGGLCCMMLFLATLYDIPQFNLTSFFVKSDE 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43155NP_572720.2 Ion_trans_2 <157..214 CDD:285168 21/56 (38%)
Ion_trans <240..314 CDD:278921 30/95 (32%)
Ion_trans_2 <266..319 CDD:285168 22/63 (35%)
twk-46NP_741678.1 Ion_trans_2 <107..164 CDD:285168 21/66 (32%)
Ion_trans_2 198..274 CDD:285168 26/75 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160163761
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4331
SonicParanoid 1 1.000 - - X19
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.870

Return to query results.
Submit another query.