DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43155 and twk-36

DIOPT Version :9

Sequence 1:NP_572720.2 Gene:CG43155 / 32092 FlyBaseID:FBgn0262685 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_507485.2 Gene:twk-36 / 180164 WormBaseID:WBGene00006688 Length:562 Species:Caenorhabditis elegans


Alignment Length:311 Identity:90/311 - (28%)
Similarity:134/311 - (43%) Gaps:84/311 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 WQSM-KWKSALNHIGLLVSLSIYCGVGGLIFRHLERPAEVERLSHLKDIVKTHRERFLHTILNNT 117
            |.:| :.|..|.:|.|||...||..:|..:|..:|...|..|| |:::                 
 Worm   158 WFAMHRKKFGLRYIALLVLALIYTLLGATVFYLIEGSNEKSRL-HVRE----------------- 204

  Fly   118 EVHNLDELLSFELAKY--EAA--VQQAAEGGLLIVADKDF-----------PEPYE--------- 158
              .|||:||. |||..  ||.  .:|::|...:    |:|           .|.|:         
 Worm   205 --QNLDKLLD-ELATVLSEAVNDPEQSSEHQRM----KEFIKESYISLQKHEEQYKWSTYYRLEH 262

  Fly   159 ----RWSILQAVFFSSTVLTTIGYGNIVPVTTGGRVFCICFALIGIPFTLTVIADWGRLF----- 214
                :|:...|.|||..|.||.|||:|...|..|::|.:.:|...:|.||.::.|.|::|     
 Worm   263 PDNLKWTFSSAFFFSMNVYTTTGYGSISAQTFSGQLFTMIYAFCFVPVTLVILRDLGQMFLVNFT 327

  Fly   215 ------ATAV-SVFGK---------HMPTKPKFTNFIGKTWFYAILAVGFLGVYLAA-GAGLLLL 262
                  .||| .:.||         .:|.|...|..|.    |.:|...|:.:|.|. |..    
 Worm   328 KLYAHGLTAVRRIRGKREVDEDEIIQLPIKFCMTILIA----YLLLCTTFVYLYDAVMGPE---- 384

  Fly   263 WEDDWTFFDGFYFCFITMTTIGFGDLVPKKPNYMLLCTLYILIGLALTSTI 313
            |:|...:|..|||.||::||||.||::|....|....::...||:|:|..:
 Worm   385 WDDGLPYFTAFYFSFISLTTIGLGDVMPNNVPYAPPVSMIFFIGMAVTKVV 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43155NP_572720.2 Ion_trans_2 <157..214 CDD:285168 22/69 (32%)
Ion_trans <240..314 CDD:278921 26/75 (35%)
Ion_trans_2 <266..319 CDD:285168 18/48 (38%)
twk-36NP_507485.2 Ion_trans_2 255..322 CDD:285168 21/66 (32%)
Ion_trans_2 361..432 CDD:285168 27/78 (35%)
Ion_trans <363..452 CDD:278921 27/81 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X19
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.