DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43155 and twk-34

DIOPT Version :9

Sequence 1:NP_572720.2 Gene:CG43155 / 32092 FlyBaseID:FBgn0262685 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_506906.3 Gene:twk-34 / 180054 WormBaseID:WBGene00006686 Length:558 Species:Caenorhabditis elegans


Alignment Length:314 Identity:78/314 - (24%)
Similarity:130/314 - (41%) Gaps:86/314 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 QSMKW------KSALNHIGLLVSLSIYCGVGGLIF----RHLERPAEVERLSHLKDIVKTHRERF 109
            :||.|      :..|.||.:.:.:..|...|..:|    ...||...:||:::|::::     ..
 Worm   150 RSMYWFAFHRKQIGLRHIMVALMVLSYTIFGAFMFWTVESRNERAVTLERVTNLENLL-----NI 209

  Fly   110 LHTILNNTEVHNLDELLSFELAKYEAAVQQA------AEG---GLLIVADKDFPEPYERWSILQA 165
            |.|  |.||:.|.....:.| |:.:..:::|      .||   |......:|..:.: :|:...|
 Worm   210 LAT--NITEIVNNPNTTTTE-AEMQVYIREAYVSLMKLEGQYKGSTYYKLEDHGKNW-KWTFESA 270

  Fly   166 VFFSSTVLTTIGYGNIVPVTTGGRVFCICFALIGIPFTLTVIADWGRLFA--------------- 215
            .|||..|.||.|||:|.|.:..|:|....:..|.:|.||..:.|.|:.|.               
 Worm   271 FFFSMNVYTTTGYGSIAPESILGQVLVCLYGFIFVPVTLVALRDLGQFFLVHLTKLYAQLIQRWR 335

  Fly   216 -----TAVSVFGKHMPTKPKFTNFIGKTWFYAILAVGFLGVYLA----------------AGAGL 259
                 |::.|            |.|.|....|.|.:  |.:|||                :|:|:
 Worm   336 EINGDTSIDV------------NEIIKIPIKACLLL--LALYLAFCTIFIHVFDELSGDESGSGM 386

  Fly   260 LLLWEDDWTFFDGFYFCFITMTTIGFGDLVPKKPNYMLLCTLYILIGLALTSTI 313
                    :.|..|||.||:::|||.||::|....:..:.::....|:|||..:
 Worm   387 --------SVFLCFYFSFISLSTIGLGDIMPNNATFSPIISIMFFFGMALTKVV 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43155NP_572720.2 Ion_trans_2 <157..214 CDD:285168 21/56 (38%)
Ion_trans <240..314 CDD:278921 24/90 (27%)
Ion_trans_2 <266..319 CDD:285168 16/48 (33%)
twk-34NP_506906.3 Ion_trans_2 250..319 CDD:285168 23/69 (33%)
Ion_trans_2 366..442 CDD:285168 18/75 (24%)
Ion_trans <387..449 CDD:278921 16/46 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160163756
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.