DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43155 and exp-2

DIOPT Version :10

Sequence 1:NP_572720.2 Gene:CG43155 / 32092 FlyBaseID:FBgn0262685 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_001367760.1 Gene:exp-2 / 179003 WormBaseID:WBGene00001374 Length:510 Species:Caenorhabditis elegans


Alignment Length:201 Identity:46/201 - (22%)
Similarity:75/201 - (37%) Gaps:56/201 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   195 FALIGIPFTLTV--IADWGRLFATAVSVFGKHMPTKPKFTNFIGKTWFYAILAVGFLGVYLAAGA 257
            |.::.|...|.|  |...|| |::.:..||..:....|        ....:..|...||...:..
 Worm   355 FLVVRILRVLRVIRIIKLGR-FSSGLQTFGMTLQRSQK--------QLQMMTIVLLTGVVFFSTM 410

  Fly   258 GLLLLWEDDWTFFD----GFYFCFITMTTIGFGDLVPKKPNYMLLCTLYILIG---LALTSTIIE 315
            ...|..:::.|.|.    .:::|.:||||:|:||.||......::.:..|:.|   |||..||| 
 Worm   411 IYFLEKDEEGTPFTSIPAAYWWCIVTMTTVGYGDAVPATTMGKIIASAAIMCGVLVLALPITII- 474

  Fly   316 LVRRQYATSWAKLQELSGPMAETLRRLGETAGTGLDYTALQKVLTVSMPKWNSKKNEHSPDIAAL 380
                  ..::.|:.: ....||                              .:||:...:..||
 Worm   475 ------VDNFIKVAQ-DEQQAE------------------------------QQKNDQQSEQLAL 502

  Fly   381 EAITNA 386
            ||:.||
 Worm   503 EAMLNA 508

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43155NP_572720.2 Ion_trans_2 143..214 CDD:462301 7/20 (35%)
Ion_trans_2 <267..319 CDD:462301 20/58 (34%)
exp-2NP_001367760.1 BTB_2 79..178 CDD:426665
Ion_trans 292..478 CDD:459842 35/138 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.