DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43155 and egl-23

DIOPT Version :9

Sequence 1:NP_572720.2 Gene:CG43155 / 32092 FlyBaseID:FBgn0262685 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_001255775.1 Gene:egl-23 / 178358 WormBaseID:WBGene00001190 Length:726 Species:Caenorhabditis elegans


Alignment Length:432 Identity:115/432 - (26%)
Similarity:168/432 - (38%) Gaps:148/432 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 EASTELLEKLKHLDRRVDAAE-----GGGL-----AKGTAGGRRSTACWQSMKWKSA---LNHIG 67
            |:.|.:.||..:   ..::.|     |.||     :..:...::....|.....|.|   ..|..
 Worm     2 ESKTAIFEKYSN---ETESKENCLVLGQGLPSKHCSNSSLSSQKMQLDWVKKAGKKATPLFVHFL 63

  Fly    68 LLVSLSIYCGVGGLIFRHL--------ERPAEVER----LSHLK------DIVKTHRERFLHTIL 114
            ::||:..|...|.|:.|.|        |:..:|.|    |::.:      .:.:.||.|..|   
 Worm    64 MIVSVGAYAIFGALVMRSLESRTVTSIEKKTDVHRRHVNLTNFQHPPTPITLEQRHRRRRRH--- 125

  Fly   115 NNTEVH-NLDELLSFE----------------------------------LAK-----YEAAVQQ 139
            |.|.:. :|.|.||.|                                  |.|     |..||:.
 Worm   126 NETALEDHLSEKLSREKRAAAHIMRSRKCVISVIKKMSSMECSFDTLDEKLVKALDECYHVAVEH 190

  Fly   140 AAEGGLLIVAD---------KDFPEPYERWSILQAVFFSSTVLTTIGYGNIVPVTTGGRVFCICF 195
            ......::..:         ::..|....||.:.::.|:.||:|||||||:.|.|.|||:|.|.:
 Worm   191 NTHVNHVLFTNSKEEVESVGEEAEEDVSEWSFMDSLLFAFTVITTIGYGNVAPRTFGGRLFVIGY 255

  Fly   196 ALIGIPFTLTVIADWGRLFATAVSVFGKHMPTKPKFTNFIGKTW----------FY--------- 241
            .||||||||..|||.|: |.:.:.|..|         :|..|||          |.         
 Worm   256 GLIGIPFTLLAIADLGK-FISEMMVEAK---------SFCRKTWKKLKKAWNPNFIRAKDLSNTD 310

  Fly   242 --------------------------------AILAVGFLGVYLAAGAGLLLLWEDDWTFFDGFY 274
                                            ..|.:.|| ||:|.|..:|..:|.|..||...|
 Worm   311 IEEKILDNEKIENEPETSEVSEEEDDLTETEATSLFILFL-VYIAFGGFMLAAYEPDMDFFKAVY 374

  Fly   275 FCFITMTTIGFGDLVPKKPNYMLLCTLYILIGLALTSTIIEL 316
            |.|:|:|:||.||:||:...|||:..:||.||||||:..||:
 Worm   375 FNFVTLTSIGLGDIVPRSETYMLITIVYIAIGLALTTIAIEI 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43155NP_572720.2 Ion_trans_2 <157..214 CDD:285168 31/56 (55%)
Ion_trans <240..314 CDD:278921 35/114 (31%)
Ion_trans_2 <266..319 CDD:285168 27/51 (53%)
egl-23NP_001255775.1 Ion_trans_2 216..276 CDD:285168 32/60 (53%)
Ion_trans_2 347..423 CDD:285168 35/71 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160163762
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X19
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.