DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43155 and kvs-5

DIOPT Version :10

Sequence 1:NP_572720.2 Gene:CG43155 / 32092 FlyBaseID:FBgn0262685 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_001294321.1 Gene:kvs-5 / 176899 WormBaseID:WBGene00021948 Length:600 Species:Caenorhabditis elegans


Alignment Length:172 Identity:39/172 - (22%)
Similarity:69/172 - (40%) Gaps:39/172 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 KSALNHIGLLVSLSIY-------CGVGGLIFRHLERPAEVERLSHLKDIVKTHR-ERFLHTILNN 116
            :..||.|.||.....|       ||:.|...|.:.......||..:..:::..: .||...:.| 
 Worm   419 RQILNVIDLLSIAPFYFELLLWICGISGENVRKVRWAFLTVRLLRVLRVIRIAKLGRFSPGLAN- 482

  Fly   117 TEVHNLDELLSFELAKYEAAVQQAAEG-----------GLLIVADKDFPEPYERWSILQAVFFSS 170
                       |.|...::..|....|           .|:...::|  ||..:::.:.|.|:..
 Worm   483 -----------FALTIRKSKKQMQMVGVVMMTVIIFFSTLIYFLERD--EPGTKFTSIPATFWWC 534

  Fly   171 TV-LTTIGYGNIVPVTTGGRVF----CICFALI-GIPFTLTV 206
            .| :.|:|||::||||..|::.    .:|..:: .:|.|:.|
 Worm   535 VVTMATVGYGDLVPVTVAGKLVGSGAIVCGVMVLALPITIMV 576

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43155NP_572720.2 Ion_trans_2 143..214 CDD:462301 21/81 (26%)
Ion_trans_2 <267..319 CDD:462301
kvs-5NP_001294321.1 BTB_POZ_Kv 139..228 CDD:349626
Ion_trans 388..587 CDD:459842 39/172 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.