DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43155 and twk-5

DIOPT Version :9

Sequence 1:NP_572720.2 Gene:CG43155 / 32092 FlyBaseID:FBgn0262685 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_001021896.1 Gene:twk-5 / 174756 WormBaseID:WBGene00006660 Length:281 Species:Caenorhabditis elegans


Alignment Length:271 Identity:72/271 - (26%)
Similarity:114/271 - (42%) Gaps:69/271 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 SILQAVFFSSTVLTTIGYGNIVPVTTGGRVFCICFALIGIPFTLTVIADWGRLFATAVSVFGKHM 225
            |..:.|||....::||||||..|.|...|||.|.|:::|||..:..:.:           |||::
 Worm    46 SFYEVVFFEFITISTIGYGNQYPQTHASRVFSIFFSILGIPLLVVTLGN-----------FGKYL 99

  Fly   226 PTKPKFTNFIGKT--WFYAILAVGFL-------GVYLAAGAGLLLLWEDDWTFFDGF-------- 273
                  |.|..||  |.::......|       |:.:|.   |.||     ||..||        
 Worm   100 ------TKFYWKTHGWIFSERTESELVNDKDMPGIVIAC---LYLL-----TFAIGFFFIPHSGA 150

  Fly   274 -------YFCFITMTTIGFGDLVPKKPNYMLLCTL--YILIGLALTSTIIELVRRQYATSWAKLQ 329
                   ||.||:..|:||||.||:...:...|.:  |::.|     ||:.::...|.|:|....
 Worm   151 AYSIDDCYFSFISFATVGFGDKVPQIDTFEKFCKVITYLVWG-----TILNIMLISYVTNWFTQL 210

  Fly   330 ELSGPMAETLRRLGETAGTGLDYTALQKVLTVS-MPKWNSKKNEHSP-DIAALEAITNAILKEVK 392
            ....|.          .||.::.....:.:||| :....:|:...|| .:.::....|.|::::|
 Worm   211 FARQPF----------RGTDVEVMIGGQCITVSEITSLVAKEFHASPHQVRSILHDINGIMEDMK 265

  Fly   393 -EAQNNKPKVL 402
             |..:.|..:|
 Worm   266 TEEDSEKSDIL 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43155NP_572720.2 Ion_trans_2 <157..214 CDD:285168 20/52 (38%)
Ion_trans <240..314 CDD:278921 25/97 (26%)
Ion_trans_2 <266..319 CDD:285168 20/69 (29%)
twk-5NP_001021896.1 Ion_trans_2 22..101 CDD:285168 23/71 (32%)
Ion_trans_2 135..209 CDD:285168 25/83 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D774951at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.