DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43155 and twk-3

DIOPT Version :9

Sequence 1:NP_572720.2 Gene:CG43155 / 32092 FlyBaseID:FBgn0262685 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_495727.1 Gene:twk-3 / 174321 WormBaseID:WBGene00006658 Length:383 Species:Caenorhabditis elegans


Alignment Length:352 Identity:87/352 - (24%)
Similarity:152/352 - (43%) Gaps:60/352 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 KSALN---------HIGLLVSLSIYCGVGGLIFRHLERPAEVER----LSHLKDIVKTHRERFLH 111
            :|.||         |.||::|...|...|..:|..:|.|.|::|    :...:|:    :::|:.
 Worm    27 RSLLNKYHLGPLALHTGLVLSCVTYALGGAYLFLSIEHPEELKRREKAIREFQDL----KQQFMG 87

  Fly   112 TILNNTEVHNLDELLSFELAKYEAAVQQAAEGGLLIVADKDFPEPYERWSILQAVFFSSTVLTTI 176
            .|.:..|  |.::.:.....|....::.|...........:...|.:.|:...|:.|::|.:..:
 Worm    88 NITSGIE--NSEQSIEIYTKKLILMLEDAHNAHAFEYFFLNHEIPKDMWTFSSALVFTTTTVIPV 150

  Fly   177 GYGNIVPVTTGGRVFCICFALIGIPFTLTVIADWGRLFATAVSVFGKHMPTKPKFTNFIGKTWF- 240
            |||.|.||:..||:..|.:||:|||.||..:||.|:..|..|:                  .|| 
 Worm   151 GYGYIFPVSAYGRMCLIAYALLGIPLTLVTMADTGKFAAQLVT------------------RWFG 197

  Fly   241 ---YAILAVGFLGVYLA--AGAGLLLLWEDDWTFFDGFYFCFITMTTIGFGDLVPKKPNYMLLCT 300
               .||.|..|:.:..|  ...|.:|....:.|:.|..||...::.|||||||.|..  .::...
 Worm   198 DNNMAIPAAIFVCLLFAYPLVVGFILCSTSNITYLDSVYFSLTSIFTIGFGDLTPDM--NVIHMV 260

  Fly   301 LYILIGLALTSTIIELV------RRQY-ATSWAKLQELSGPMAETLRRL----GETAGTGLDYTA 354
            |::.:|:.|.:..:::|      |..| .....|.:||:|.|.:..:.|    |..:|.|..:..
 Worm   261 LFLAVGVILVTITLDIVAAEMIDRVHYMGRHVGKAKELAGKMFQLAQSLNMKQGLVSGVGQLHAL 325

  Fly   355 LQKVLTVSMPKWNSKKNE----HSPDI 377
            .:..:.|...:.:..:.:    .|||:
 Worm   326 ARFGMLVGREEVDKTQEDGIIAFSPDV 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43155NP_572720.2 Ion_trans_2 <157..214 CDD:285168 23/56 (41%)
Ion_trans <240..314 CDD:278921 23/79 (29%)
Ion_trans_2 <266..319 CDD:285168 16/58 (28%)
twk-3NP_495727.1 Ion_trans_2 <134..190 CDD:285168 23/55 (42%)
Ion_trans_2 211..283 CDD:285168 19/73 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D542195at33208
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.780

Return to query results.
Submit another query.