DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43155 and sup-9

DIOPT Version :9

Sequence 1:NP_572720.2 Gene:CG43155 / 32092 FlyBaseID:FBgn0262685 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_494333.1 Gene:sup-9 / 173613 WormBaseID:WBGene00006318 Length:329 Species:Caenorhabditis elegans


Alignment Length:279 Identity:83/279 - (29%)
Similarity:127/279 - (45%) Gaps:61/279 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 IGLLVSLSIYCGVGGLIFRHLERPAEVERLSHLKDIVKTHRERFLHTILNNTEVHNLD-ELLSFE 129
            :.|:|....|..||..:|..||...|:.:    :.:|:..||: |.|..|   :.|.| |:|...
 Worm     9 LSLIVCTLTYLLVGAAVFDALETENEILQ----RKLVQRVREK-LKTKYN---MSNADYEILEAT 65

  Fly   130 LAK---YEAAVQQAAEGGLLIVADKDFPEPYERWSILQAVFFSSTVLTTIGYGNIVPVTTGGRVF 191
            :.|   ::|..|                     |....|.:|::||:||||||:..|:|..|:||
 Worm    66 IVKSVPHKAGYQ---------------------WKFSGAFYFATTVITTIGYGHSTPMTDAGKVF 109

  Fly   192 CICFALIGIPFTLTVIADWGRLFATAVSVFGKHMPTKPKFTNFI----GKTWFYA-----ILAVG 247
            |:.:||.|||..|.:....|....|..:          |...||    ||.....     |...|
 Worm   110 CMLYALAGIPLGLIMFQSIGERMNTFAA----------KLLRFIRRAAGKQPIVTSSDLIIFCTG 164

  Fly   248 FLGVYLAAGAGLLLLWEDDWTFFDGFYFCFITMTTIGFGDLV--------PKKPNYMLLCTLYIL 304
            :.|:.:..||.:...:| :||:||..|:||:|:|||||||.|        ..:|.|:....::||
 Worm   165 WGGLLIFGGAFMFSSYE-NWTYFDAVYYCFVTLTTIGFGDYVALQKRGSLQTQPEYVFFSLVFIL 228

  Fly   305 IGLALTSTIIELVRRQYAT 323
            .||.:.|..:.|:..::.|
 Worm   229 FGLTVISAAMNLLVLRFLT 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43155NP_572720.2 Ion_trans_2 <157..214 CDD:285168 24/56 (43%)
Ion_trans <240..314 CDD:278921 29/86 (34%)
Ion_trans_2 <266..319 CDD:285168 24/60 (40%)
sup-9NP_494333.1 Ion_trans_2 <77..132 CDD:311712 25/75 (33%)
Ion_trans_2 168..242 CDD:311712 27/74 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160163755
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X19
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.