DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43155 and Kcnk15

DIOPT Version :9

Sequence 1:NP_572720.2 Gene:CG43155 / 32092 FlyBaseID:FBgn0262685 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_570826.1 Gene:Kcnk15 / 156873 RGDID:619733 Length:318 Species:Rattus norvegicus


Alignment Length:300 Identity:87/300 - (28%)
Similarity:121/300 - (40%) Gaps:60/300 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 KSALNHIGLLVSLSIYCGVGGLIFRHLERPAEVERLSHLKDIVKTHRERFLHTILNNTEVHNLDE 124
            |.:.....|::.:..|..||..:|..||..||..|    :.::...|..|......:.:.:...|
  Rat     3 KQSARTAALILCILSYLLVGAAVFDALESEAERSR----QRLLARKRGEFRRKYRFSADDYRELE 63

  Fly   125 LLSFELAKYEAAVQQAAEGGLLIVADKDFPEPYERWSILQAVFFSSTVLTTIGYGNIVPVTTGGR 189
            .|:.:...:.|..|                     |....:.:|:.||:||||||:..|.|..|:
  Rat    64 RLALQAEPHRAGRQ---------------------WRFAGSFYFAITVITTIGYGHAAPGTDSGK 107

  Fly   190 VFCICFALIGIPFTLTVIADWGR--------LFATAVSVFGKHMPTKPKFTNFIGKTWFYAILAV 246
            |||:.:||:|||.||......|.        |...|....|...| .....|.:         ..
  Rat   108 VFCMFYALLGIPLTLVTFQSLGERLNALVRCLLLAAKRCLGLRRP-HVSAENMV---------VA 162

  Fly   247 GFL--GVYLAAGAGLLLLWEDDWTFFDGFYFCFITMTTIGFGDLV--------PKKPNYMLLCTL 301
            |.|  ...||.||.....:| .||||..:|:||||:|||||||.|        .|||.|:....|
  Rat   163 GLLLCAATLALGAAAFAHFE-GWTFFHAYYYCFITLTTIGFGDFVALQRDEALQKKPPYVAFSFL 226

  Fly   302 YILIGLALTSTIIELVRRQYATSWAKLQELSGPMAETLRR 341
            |||:||.:....:.||..::      |.....|....|||
  Rat   227 YILLGLTVIGAFLNLVVLRF------LASAEAPERAALRR 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43155NP_572720.2 Ion_trans_2 <157..214 CDD:285168 24/64 (38%)
Ion_trans <240..314 CDD:278921 34/83 (41%)
Ion_trans_2 <266..319 CDD:285168 29/60 (48%)
Kcnk15NP_570826.1 Ion_trans_2 <77..132 CDD:285168 25/75 (33%)
Ion_trans_2 <182..243 CDD:285168 29/61 (48%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 296..318
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X19
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.