DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43155 and Kcnd1

DIOPT Version :10

Sequence 1:NP_572720.2 Gene:CG43155 / 32092 FlyBaseID:FBgn0262685 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_001099218.1 Gene:Kcnd1 / 116695 RGDID:621364 Length:650 Species:Rattus norvegicus


Alignment Length:59 Identity:18/59 - (30%)
Similarity:37/59 - (62%) Gaps:6/59 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 SILQAVFFSSTVLTTIGYGNIVPVTTGGRVF-CIC----FALIGIPFTLTVIADWGRLF 214
            ||..|.:::...:||:|||::||.|..|::| .||    ..:|.:|..: :::::.|::
  Rat   358 SIPAAFWYTIVTMTTLGYGDMVPSTIAGKIFGSICSLSGVLVIALPVPV-IVSNFSRIY 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43155NP_572720.2 Ion_trans_2 143..214 CDD:462301 18/57 (32%)
Ion_trans_2 <267..319 CDD:462301
Kcnd1NP_001099218.1 BTB_POZ 6..143 CDD:453885
Ion_trans 185..417 CDD:459842 18/59 (31%)
DUF3399 470..550 CDD:463381
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.