DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43155 and Kcnk6

DIOPT Version :9

Sequence 1:NP_572720.2 Gene:CG43155 / 32092 FlyBaseID:FBgn0262685 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_446258.2 Gene:Kcnk6 / 116491 RGDID:621450 Length:313 Species:Rattus norvegicus


Alignment Length:274 Identity:83/274 - (30%)
Similarity:131/274 - (47%) Gaps:49/274 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 LVSLSIYCGVGGLIFRHLERPAEVERLSHLKDIVKTHRERFL-HTILNNTEVHNLDELLSFELAK 132
            ||:.:.|..:|.|:...||||.|    :.|:..:.|.||:.| |:..  ...|.||..:...|| 
  Rat    11 LVAYAGYLALGALLVARLERPHE----ARLRAELGTLREQLLRHSPC--VAAHALDAFVERVLA- 68

  Fly   133 YEAAVQQAAEGGLLIVADKDFP----EPYERWSILQAVFFSSTVLTTIGYGNIVPVTTGGRVFCI 193
                   |...|..::|:...|    :|  .|....|:||:||::||:|||...|:|..|:.|.|
  Rat    69 -------AGRLGRAVLANASGPANASDP--AWDFASALFFASTLVTTVGYGYTTPLTDAGKAFSI 124

  Fly   194 CFALIGIPFTLTVIADWGRLFATAVSVFGKHMPTKPKFTNFIGKTW-----------FYAILAVG 247
            .|||:|:|.|:.::.    ..|..:|:...|.|     .:::...|           ..|:|.| 
  Rat   125 VFALLGVPITMLLLT----ASAQRLSLLLTHAP-----LSWLSLRWGWHPQRAARWHLVALLMV- 179

  Fly   248 FLGVYLAAGAGLLLLWEDDWTFFDGFYFCFITMTTIGFGDLVP-KKPN------YMLLCTLYILI 305
            .:.::....|.:....|:.|:|.|.||||||:::|||.||.|| :.|.      |.:|.|.|:.:
  Rat   180 IVAIFFLIPAAVFAYLEEAWSFLDAFYFCFISLSTIGLGDYVPGEAPGQPYRSLYKVLVTAYLFL 244

  Fly   306 GLALTSTIIELVRR 319
            ||.....:::..||
  Rat   245 GLVAMVLVLQTFRR 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43155NP_572720.2 Ion_trans_2 <157..214 CDD:285168 22/56 (39%)
Ion_trans <240..314 CDD:278921 28/80 (35%)
Ion_trans_2 <266..319 CDD:285168 23/59 (39%)
Kcnk6NP_446258.2 Ion_trans_2 <91..146 CDD:400301 23/58 (40%)
Ion_trans_2 180..259 CDD:400301 27/79 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 64 1.000 Domainoid score I9874
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 1 1.000 - - otm44944
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X19
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.810

Return to query results.
Submit another query.