DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43155 and Kcnk4

DIOPT Version :9

Sequence 1:NP_572720.2 Gene:CG43155 / 32092 FlyBaseID:FBgn0262685 Length:411 Species:Drosophila melanogaster
Sequence 2:XP_006230696.1 Gene:Kcnk4 / 116489 RGDID:621449 Length:423 Species:Rattus norvegicus


Alignment Length:350 Identity:99/350 - (28%)
Similarity:148/350 - (42%) Gaps:90/350 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 AAEGGGLAKGTAGGRRSTACWQSMKWKSALNHIGLLVSLSIYCGVGGLIFRHLERPAEVERLSHL 98
            |..|.|.|.|.|  .|||..            :.||..:.:|...|.|:|:.||:|.|.:....|
  Rat    15 AGSGAGPAPGRA--MRSTTL------------LALLALVLLYLVSGALVFQALEQPHEQQVQKDL 65

  Fly    99 KDIVKTHRERFL--HTILNNTEVHNLDELLSFELAKYEAAVQQAAEGGLLIVADKDFPEP----- 156
            :|    .|::||  |..::...:....:|           |.:|..||.       .||.     
  Rat    66 ED----GRDQFLKDHPCVSQKNLEGFIKL-----------VAEALGGGA-------NPETSWTNS 108

  Fly   157 ---YERWSILQAVFFSSTVLTTIGYGNIVPVTTGGRVFCICFALIGIPFTLTVIADWGRLFATAV 218
               ...|::..|.|||.|::||||||||...|..||:|||.:||:|||....::|..|....:::
  Rat   109 SNHSSAWNLGSAFFFSGTIITTIGYGNIALHTDAGRLFCIFYALVGIPLFGMLLAGVGDRLGSSL 173

  Fly   219 --------SVFGK-HMPTKPKFTNFIGKTWFYAILAVGFLGVYLAAGAGLLLLWEDDWTFFDGFY 274
                    :||.| |:|  |.....:....|   |.:|.|...|.  ...:..:.:.|:..:..|
  Rat   174 RRGIGHIEAVFLKWHVP--PGLVRMLSAVLF---LLIGCLLFVLT--PTFVFSYMESWSKLEAIY 231

  Fly   275 FCFITMTTIGFGDLVP------KKPNYMLLCTLYILIGLALTSTIIELV--------RR------ 319
            |..:|:||:||||.||      ..|.|..|...:||.|||..::::..:        ||      
  Rat   232 FVIVTLTTVGFGDYVPGDGTGQNSPAYQPLVWFWILFGLAYFASVLTTIGNWLRAVSRRTRAEMG 296

  Fly   320 ---QYATSW-----AKLQELSGPMA 336
               ..|.||     |::.:.:||.|
  Rat   297 GLTAQAASWTGTVTARVTQRTGPSA 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43155NP_572720.2 Ion_trans_2 <157..214 CDD:285168 27/56 (48%)
Ion_trans <240..314 CDD:278921 25/79 (32%)
Ion_trans_2 <266..319 CDD:285168 20/66 (30%)
Kcnk4XP_006230696.1 Ion_trans_2 <115..169 CDD:285168 27/53 (51%)
Ion_trans_2 207..285 CDD:285168 22/79 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 1 1.000 - - otm44944
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X19
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.910

Return to query results.
Submit another query.