DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43155 and kcnk17

DIOPT Version :9

Sequence 1:NP_572720.2 Gene:CG43155 / 32092 FlyBaseID:FBgn0262685 Length:411 Species:Drosophila melanogaster
Sequence 2:XP_005158968.1 Gene:kcnk17 / 101882139 ZFINID:ZDB-GENE-120113-3 Length:299 Species:Danio rerio


Alignment Length:257 Identity:77/257 - (29%)
Similarity:124/257 - (48%) Gaps:45/257 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 YCGVGGLIFRHLERPAEVERLSHLKDIVKTHRERFLHTILNNTEVHNLDELL-SFELAKYEAAVQ 138
            |..||||:|..||....:::::.||:......|::  ..|....:..|.::: |..|:.......
Zfish    31 YVLVGGLVFWKLEGWYVLQQIALLKEKRLELLEKY--PCLGQNGLSELAQMIKSASLSGLSPDSN 93

  Fly   139 QAAEGGLLIVADKDFPEPYERWSILQAVFFSSTVLTTIGYGNIVPVTTGGRVFCICFALIGIPFT 203
            ..|:|               .|....:..|::||:||||||||||:||.|::||:.|||.|||..
Zfish    94 DTADG---------------LWKFTSSSVFAATVVTTIGYGNIVPLTTAGQIFCVMFALFGIPLN 143

  Fly   204 LTVIADWGRLFATAVSVFGKHM-PTKPKFTNFI------GKTWFYAILAVGFL-GVYLAAGAGLL 260
            :.|:           :..||:| ..:..|.||:      ||....:|.::.|: ..:|.....:|
Zfish   144 VVVL-----------NRVGKYMLAIERHFCNFLEKKIDRGKCVRISIHSISFVSSAFLYLVVPML 197

  Fly   261 LLWE-DDWTFFDGFYFCFITMTTIGFGDLV-PKKPN------YMLLCTLYILIGLALTSTII 314
            |..| :.|::.:..|:||||::||||||.| ...|.      |..|..::|..|||..:.::
Zfish   198 LFKEYEGWSYAEAIYYCFITLSTIGFGDYVADHNPEINYPEWYSCLMAVWIFFGLAWLALLV 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43155NP_572720.2 Ion_trans_2 <157..214 CDD:285168 26/56 (46%)
Ion_trans <240..314 CDD:278921 26/82 (32%)
Ion_trans_2 <266..319 CDD:285168 20/56 (36%)
kcnk17XP_005158968.1 Ion_trans_2 <100..154 CDD:285168 28/64 (44%)
Ion_trans_2 189..267 CDD:285168 24/71 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X19
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.