DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43155 and LOC101731658

DIOPT Version :9

Sequence 1:NP_572720.2 Gene:CG43155 / 32092 FlyBaseID:FBgn0262685 Length:411 Species:Drosophila melanogaster
Sequence 2:XP_031758165.1 Gene:LOC101731658 / 101731658 -ID:- Length:331 Species:Xenopus tropicalis


Alignment Length:253 Identity:81/253 - (32%)
Similarity:119/253 - (47%) Gaps:35/253 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 LLVSLSIYCGVGGLIFRHLERPAEVER-LSHLKDIVKTHRERFLHTILNNTEVHNLDELLSFELA 131
            ||:....|..||..:|..||...|||: :|..:|..:..|.   .|.::|   ..|:..:...:.
 Frog    21 LLLIYICYLLVGAAVFWALESQTEVEQSVSFQQDKWELLRN---FTCMDN---RTLELFIKTVIG 79

  Fly   132 KYEAAVQQAAEGGLLIVADKDFPEPYERWSILQAVFFSSTVLTTIGYGNIVPVTTGGRVFCICFA 196
            .|::.:........|           ..||...:.|||.||:|||||||:.|.|.|.|.||:.:|
 Frog    80 AYKSGISPEGNSSNL-----------GSWSFGGSFFFSVTVVTTIGYGNLCPSTAGARAFCVVYA 133

  Fly   197 LIGIPFTLTVIADWGRLFATAV----SVFGKHMPTKPKFTNFIGKTWFYAILAVGFLGVYLAAGA 257
            |.|||..|.::...|:...:.|    .|.||.: .:.:.|..:...   :.|.:|.|...|.  .
 Frog   134 LFGIPLNLILLNRIGQKMLSLVHRCGDVVGKRI-RRQRLTKLVTSG---SALLIGLLLFMLL--P 192

  Fly   258 GLLLLWEDDWTFFDGFYFCFITMTTIGFGDLV----PKK--PN-YMLLCTLYILIGLA 308
            .:|....:.||:.:|.|:.|||:.||||||.|    |.|  || |..|.:::||.|||
 Frog   193 PVLFRAVEGWTYGEGLYYSFITLATIGFGDYVVGRNPDKQYPNWYRNLLSVWILFGLA 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43155NP_572720.2 Ion_trans_2 <157..214 CDD:285168 27/56 (48%)
Ion_trans <240..314 CDD:278921 30/76 (39%)
Ion_trans_2 <266..319 CDD:285168 25/50 (50%)
LOC101731658XP_031758165.1 Ion_trans_2 92..151 CDD:400301 28/69 (41%)
Ion_trans_2 194..264 CDD:400301 26/57 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X19
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.