DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43155 and KCNK7

DIOPT Version :9

Sequence 1:NP_572720.2 Gene:CG43155 / 32092 FlyBaseID:FBgn0262685 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_203133.1 Gene:KCNK7 / 10089 HGNCID:6282 Length:307 Species:Homo sapiens


Alignment Length:307 Identity:77/307 - (25%)
Similarity:129/307 - (42%) Gaps:80/307 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 GLLVSLSIYC-GVGGLIFRHLERP----AEVERLSHLKDIVKTHR--------ERFLHTILNNTE 118
            ||||...:.. |:|.::|:.||.|    .:.|..:.|......||        |..|.|.| .|:
Human    11 GLLVVAHLLALGLGAVVFQALEGPPACRLQAELRAELAAFQAEHRACLPPGALEELLGTAL-ATQ 74

  Fly   119 VHNLDELLSFELAKYEAAVQQAAEGGLLIVADKDFPEPYERWSILQAVFFSSTVLTTIGYGNIVP 183
            .|.:..|            ..::||              ..|.:..|:.|::::|||.|||::.|
Human    75 AHGVSTL------------GNSSEG--------------RTWDLPSALLFAASILTTTGYGHMAP 113

  Fly   184 VTTGGRVFCICFALIGIPFTLTVIADWGRLFATAVSVFGKH--MPTKPKFTNFIGKTWFY----- 241
            ::.||:.||:.:|.:|:|.:|.::|..            :|  :|...:...::...|..     
Human   114 LSPGGKAFCMVYAALGLPASLALVATL------------RHCLLPVLSRPRAWVAVHWQLSPARA 166

  Fly   242 AILAVGFLGVYLAAGAGL---LLLW--EDDWTFFDGFYFCFITMTTIGFGDLVPKKPNYM----- 296
            |:|....||:.:|:...|   |:||  :.|.:.....||||.:::|||..||:|.:...:     
Human   167 ALLQAVALGLLVASSFVLLPALVLWGLQGDCSLLGAVYFCFSSLSTIGLEDLLPGRGRSLHPVIY 231

  Fly   297 ----LLCTLYILIG----LALTSTIIELVRRQYATSWAKLQELSGPM 335
                |....|:|:|    |....|..||.:   ..:..|....|||:
Human   232 HLGQLALLGYLLLGLLAMLLAVETFSELPQ---VRAMGKFFRPSGPV 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43155NP_572720.2 Ion_trans_2 <157..214 CDD:285168 19/56 (34%)
Ion_trans <240..314 CDD:278921 26/96 (27%)
Ion_trans_2 <266..319 CDD:285168 19/65 (29%)
KCNK7NP_203133.1 Ion_trans_2 <90..140 CDD:285168 19/49 (39%)
Ion_trans_2 182..>220 CDD:285168 14/37 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X19
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.