DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43155 and kcnk16

DIOPT Version :9

Sequence 1:NP_572720.2 Gene:CG43155 / 32092 FlyBaseID:FBgn0262685 Length:411 Species:Drosophila melanogaster
Sequence 2:XP_002942063.2 Gene:kcnk16 / 100496127 XenbaseID:XB-GENE-996240 Length:293 Species:Xenopus tropicalis


Alignment Length:298 Identity:91/298 - (30%)
Similarity:138/298 - (46%) Gaps:81/298 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 WQSMKWKSALNHIGLLVSLS----IYCGVGGLIFRHLERPAEVERLSHLKDIVKTHRERFL--HT 112
            ||..:.:   ..|.|.|:||    :|..:|.::|:.||:.||    |:.:|..:..:.|||  :|
 Frog     2 WQIFQCR---RQISLSVALSLGYFLYLFLGAMMFQILEKQAE----SNTRDQFQVAKLRFLQNYT 59

  Fly   113 ILNNTEVHNLDELLSFELAKYEAAVQQAAEGGLLIVADKDFPEPYERWSILQAVFFSSTVLTTIG 177
            .|   :|:.|::.:..        :.:|.|.||....:...|   ..|....:.||:.||:||||
 Frog    60 CL---DVNALEQFVQI--------IMEAWEKGLNPKGNATNP---SNWDFSNSFFFAGTVITTIG 110

  Fly   178 YGNIVPVTTGGRVFCICFALIGIPFTLTVIADWGRLFATAVSVFGKHMPTKPKFTNFIGKTWFYA 242
            |||:.|.|..|:|||:.:||.|||..|.                         |.|.|||:....
 Frog   111 YGNLYPSTVAGQVFCVFYALFGIPLNLA-------------------------FLNLIGKSLNTH 150

  Fly   243 ILAVG---------------FLGVYLAAGAGLLLL-------WEDDWTFFDGFYFCFITMTTIGF 285
            :||:|               .:..|||.|:.|:|:       :.:.|::.:||||.|||::||||
 Frog   151 LLALGRITRRPQGSGAMKLLVMATYLALGSLLVLVLPPMIFSYVEGWSYGEGFYFAFITLSTIGF 215

  Fly   286 GDLV-PKKPN------YMLLCTLYILIGLALTSTIIEL 316
            ||.| ...||      |..|..|:|:.|||..:.:..|
 Frog   216 GDYVLGTDPNKHYISIYRSLAALWIISGLAWLALVFSL 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43155NP_572720.2 Ion_trans_2 <157..214 CDD:285168 24/56 (43%)
Ion_trans <240..314 CDD:278921 33/102 (32%)
Ion_trans_2 <266..319 CDD:285168 25/58 (43%)
kcnk16XP_002942063.2 Ion_trans_2 <88..147 CDD:369572 30/86 (35%)
Ion_trans_2 <193..259 CDD:369572 25/61 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 67 1.000 Domainoid score I9679
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X19
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.010

Return to query results.
Submit another query.