DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43155 and kcnk15

DIOPT Version :9

Sequence 1:NP_572720.2 Gene:CG43155 / 32092 FlyBaseID:FBgn0262685 Length:411 Species:Drosophila melanogaster
Sequence 2:XP_004918713.1 Gene:kcnk15 / 100492337 XenbaseID:XB-GENE-6065312 Length:411 Species:Xenopus tropicalis


Alignment Length:307 Identity:93/307 - (30%)
Similarity:140/307 - (45%) Gaps:61/307 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 SMKWKSALNHIGLLVSLSIYCGVGGLIFRHLERPAEVERLSHLKDIVKTHRERFLHTILNNTEVH 120
            :|| |..:..:.|::.:..|..||..:|..||..:|:.|    |.|::..|       ||....:
 Frog    12 TMK-KQNIRTLSLILCMFSYLLVGAAVFDALESESEISR----KRILEEKR-------LNLRNKY 64

  Fly   121 NL-DELLSFELAKYEAAVQQAAEGGLLIVADKDFPEPY---ERWSILQAVFFSSTVLTTIGYGNI 181
            .. ||    :..:.|..|||:              ||:   ::|....:.:|:.||:||||||:.
 Frog    65 GFSDE----DYREIERVVQQS--------------EPHRAGKQWKFAGSFYFAITVITTIGYGHA 111

  Fly   182 VPVTTGGRVFCICFALIGIPFTLTVIADWGRLFATAVSVFGKHM-------PTKPKFTNFIGKTW 239
            .|.|..|:|||:.:|::|||.||.:....|....|.|....|.:       .|:....|.:    
 Frog   112 APGTDAGKVFCMFYAVLGIPLTLVMFQSLGERMNTFVRFLLKKLKRCFRLRKTEVSMENMV---- 172

  Fly   240 FYAILAVGFLGVY--LAAGAGLLLLWEDDWTFFDGFYFCFITMTTIGFGDLV--------PKKPN 294
                 .||||...  |..||.....:| .||||..:|:||||:|||||||.|        .|||.
 Frog   173 -----LVGFLSCIGTLGIGAAAFSYFE-GWTFFHSYYYCFITLTTIGFGDFVALQKNEALQKKPP 231

  Fly   295 YMLLCTLYILIGLALTSTIIELVRRQYATSWAKLQELSGPMAETLRR 341
            |:....:|||:||.:....:.||..::.|..::.:........:|||
 Frog   232 YVAFSFMYILVGLTVIGAFLNLVVLRFLTMNSEDERRDAEERASLRR 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43155NP_572720.2 Ion_trans_2 <157..214 CDD:285168 23/59 (39%)
Ion_trans <240..314 CDD:278921 34/83 (41%)
Ion_trans_2 <266..319 CDD:285168 28/60 (47%)
kcnk15XP_004918713.1 Ion_trans_2 <89..144 CDD:369572 23/54 (43%)
Ion_trans_2 <192..255 CDD:369572 28/63 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X19
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.