DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43155 and kcnk9

DIOPT Version :9

Sequence 1:NP_572720.2 Gene:CG43155 / 32092 FlyBaseID:FBgn0262685 Length:411 Species:Drosophila melanogaster
Sequence 2:XP_004915092.1 Gene:kcnk9 / 100379982 XenbaseID:XB-GENE-952039 Length:473 Species:Xenopus tropicalis


Alignment Length:275 Identity:81/275 - (29%)
Similarity:119/275 - (43%) Gaps:52/275 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 IGLLVSLSIYCGVGGLIFRHLERPAEVERLSHLKDIVKTHRERFLHTILNNTEVHNLDELLSFEL 130
            :.|::....|..||..:|..||...|:.....||  .:..|.:..:.|  .:|.:...||:..:.
 Frog   108 LSLIICTFTYLLVGAAVFDALESDYEMREEEKLK--AEEIRLKGKYNI--TSEDYRQLELVIMQS 168

  Fly   131 AKYEAAVQQAAEGGLLIVADKDFPEPYERWSILQAVFFSSTVLTTIGYGNIVPVTTGGRVFCICF 195
            ..:.|.||                     |....:.:|:.||:||||||:..|.|..|:.||:.:
 Frog   169 EPHRAGVQ---------------------WKFAGSFYFAITVITTIGYGHAAPGTDAGKAFCMFY 212

  Fly   196 ALIGIPFTLTVIADWGRLFATAVSVFGKHM-------PTKPKFTNFIGKTWFYAILAVGFLGVY- 252
            |::|||.||.:....|....|.|....|.:       .|.....|.:         .|||.... 
 Frog   213 AVLGIPLTLVMFQSLGERMNTFVKYLLKRIKKCCGMRSTDVSMENMV---------TVGFFSCMG 268

  Fly   253 -LAAGAGLLLLWEDDWTFFDGFYFCFITMTTIGFGDLV--------PKKPNYMLLCTLYILIGLA 308
             |..||.....:| ||:||..:|:||||:|||||||.|        .|||.|:....:|||:||.
 Frog   269 TLCIGAAAFSHYE-DWSFFQSYYYCFITLTTIGFGDYVALQKNRALQKKPLYVAFSFMYILVGLT 332

  Fly   309 LTSTIIELVRRQYAT 323
            :....:.||..::.|
 Frog   333 VIGAFLNLVVLRFLT 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43155NP_572720.2 Ion_trans_2 <157..214 CDD:285168 22/56 (39%)
Ion_trans <240..314 CDD:278921 33/83 (40%)
Ion_trans_2 <266..319 CDD:285168 28/60 (47%)
kcnk9XP_004915092.1 Ion_trans_2 <176..231 CDD:369572 23/75 (31%)
Ion_trans_2 269..342 CDD:369572 31/73 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X19
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.