DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43155 and kcnk7

DIOPT Version :9

Sequence 1:NP_572720.2 Gene:CG43155 / 32092 FlyBaseID:FBgn0262685 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_001116288.1 Gene:kcnk7 / 100144289 XenbaseID:XB-GENE-5731928 Length:322 Species:Xenopus tropicalis


Alignment Length:357 Identity:93/357 - (26%)
Similarity:145/357 - (40%) Gaps:126/357 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 MKWKSALNHIGLLVSLSIYCGVGGLIFRHLERPAEVERLSHLKDIVKTHRERFLHTILNNTEVHN 121
            |..:.||..:.||:|.|::..:|..:|..||:|.| |||         .||              
 Frog     1 MVGRRALFLLLLLLSYSLFLLLGAFVFSTLEQPQE-ERL---------RRE-------------- 41

  Fly   122 LDELLSFELAKY----EAAVQQAAEGGLLIVADKDFPEPYER--------WSILQAVFFSSTVLT 174
            ::.:.|..|||:    |..:.......||:   |.|.....|        |..:.::||:.|.||
 Frog    42 VETMWSEFLAKHPCLSEVLLDDFIRKALLV---KSFGVSVHRNISIHELKWDFISSLFFTGTTLT 103

  Fly   175 TIGYGNIVPVTTGGRVFCICFALIGIPFTLTVIA-----------------------------DW 210
            |||||:..|::.||:.||:.:|:.|||.||:|::                             :|
 Frog   104 TIGYGHPFPISLGGKAFCLVYAIFGIPLTLSVLSIIVRNLLILLWDKPINKLQRQCSISRKKLEW 168

  Fly   211 GRLFATAVSVFGKHMPTKPKFTNFIGKTWFYAILAVGFLGVYLAAGAGLLLLWEDDWTFFDGFYF 275
               ...::.:|         ||..|    |:.|.|:.|..:            |::|.:.|..||
 Frog   169 ---ILASIFIF---------FTALI----FFFIPAIVFNAI------------EENWGYVDALYF 205

  Fly   276 CFITMTTIGFGDLVPKKPN-------YMLLCTLYILIGLALTSTIIELV---------------- 317
            |||:::|||.||.||.:.|       |.||...|:||||.....::|::                
 Frog   206 CFISLSTIGLGDYVPGERNEQRLPVLYKLLVICYLLIGLVAVFLVVEVIKNVLNYNRLFGLFLFG 270

  Fly   318 --RRQYATSWAKLQELSGPMAE-----TLRRL 342
              ||.:.|......:..||:.:     |.||:
 Frog   271 EDRRDWETGCDLACKAGGPIVQKHEEKTRRRV 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43155NP_572720.2 Ion_trans_2 <157..214 CDD:285168 25/93 (27%)
Ion_trans <240..314 CDD:278921 28/80 (35%)
Ion_trans_2 <266..319 CDD:285168 24/77 (31%)
kcnk7NP_001116288.1 Ion_trans_2 <88..141 CDD:285168 23/52 (44%)
Ion_trans_2 178..254 CDD:285168 31/91 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X19
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.