Sequence 1: | NP_572720.2 | Gene: | CG43155 / 32092 | FlyBaseID: | FBgn0262685 | Length: | 411 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001108379.1 | Gene: | kcnq2a / 100141342 | ZFINID: | ZDB-GENE-080220-37 | Length: | 349 | Species: | Danio rerio |
Alignment Length: | 258 | Identity: | 51/258 - (19%) |
---|---|---|---|
Similarity: | 93/258 - (36%) | Gaps: | 87/258 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 7 TVKEYDSQDEASTELLE-----------------------------KLKH-------LDRRVDAA 35
Fly 36 EGGGLAKGTAGGRRSTACWQSMKWKSALNHIGLLVSLSIYCGVGGLIFRHLERPAEVERLSHLKD 100
Fly 101 IVKTHRERFLHTILNNTEVHNLDELLSFELAKYEAAVQQAAEGGLLIVADKDFPEPYERWSILQA 165
Fly 166 VFFSSTVLTTIGYGNIVPVTTGGRVFCICFALIGIPFTLTVIADWGRLFATAVSVFGKHMPTK 228 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG43155 | NP_572720.2 | Ion_trans_2 | <157..214 | CDD:285168 | 19/56 (34%) |
Ion_trans | <240..314 | CDD:278921 | |||
Ion_trans_2 | <266..319 | CDD:285168 | |||
kcnq2a | NP_001108379.1 | Ion_trans | 119..325 | CDD:278921 | 47/253 (19%) |
Ion_trans_2 | 240..315 | CDD:285168 | 28/113 (25%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D774951at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.010 |