DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43155 and kcnq2a

DIOPT Version :9

Sequence 1:NP_572720.2 Gene:CG43155 / 32092 FlyBaseID:FBgn0262685 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_001108379.1 Gene:kcnq2a / 100141342 ZFINID:ZDB-GENE-080220-37 Length:349 Species:Danio rerio


Alignment Length:258 Identity:51/258 - (19%)
Similarity:93/258 - (36%) Gaps:87/258 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 TVKEYDSQDEASTELLE-----------------------------KLKH-------LDRRVDAA 35
            |:|||....|::..:||                             :|:.       :|..|..|
Zfish   114 TIKEYKKSSESALYILEIVTIVVFGVEYIVRIWAAGCCCRYRGWRGRLRFARKPFCIIDIMVLFA 178

  Fly    36 EGGGLAKGTAGGRRSTACWQSMKWKSALNHIGLLVSLSIYCGVGGLIFRHLERPAEVERLSHLKD 100
            ....||.|:.|...:|:..:|:::...|..:.:......:..:|.:::            :|.|:
Zfish   179 SVSVLAAGSQGNVFATSAIRSLRFLQILRMLRMDRRGGTWKLLGSVVY------------AHSKE 231

  Fly   101 IVKTHRERFLHTILNNTEVHNLDELLSFELAKYEAAVQQAAEGGLLIVADKDFPEPYERWSILQA 165
            ::......||..||.:..|:::::                          .|..|.:|.::  .|
Zfish   232 LITAWYIGFLCLILASFLVYSVEK--------------------------DDNAEMFETYA--DA 268

  Fly   166 VFFSSTVLTTIGYGNIVPVTTGGRVFCICFALIGIPFTLTVIADWGRLFATAVSVFGKHMPTK 228
            :::....|||||||:..|||..||:....|:|||:.|           ||....:.|.....|
Zfish   269 LWWGLVTLTTIGYGDKFPVTWNGRLIAATFSLIGVAF-----------FALPAGILGSGFALK 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43155NP_572720.2 Ion_trans_2 <157..214 CDD:285168 19/56 (34%)
Ion_trans <240..314 CDD:278921
Ion_trans_2 <266..319 CDD:285168
kcnq2aNP_001108379.1 Ion_trans 119..325 CDD:278921 47/253 (19%)
Ion_trans_2 240..315 CDD:285168 28/113 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D774951at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.