DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43155 and si:ch211-261a10.5

DIOPT Version :9

Sequence 1:NP_572720.2 Gene:CG43155 / 32092 FlyBaseID:FBgn0262685 Length:411 Species:Drosophila melanogaster
Sequence 2:XP_021321992.1 Gene:si:ch211-261a10.5 / 100003275 ZFINID:ZDB-GENE-131127-398 Length:306 Species:Danio rerio


Alignment Length:197 Identity:45/197 - (22%)
Similarity:86/197 - (43%) Gaps:34/197 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   183 PVTTGGRVFCICFALIGIPFT--------------LTVIADWGRLFATAVSVFGKH----MPTKP 229
            |.|..|::|.|.:.|||...|              :|.:.:..|..........:|    :.|.|
Zfish     4 PATHNGKIFLIFYGLIGCATTMLFFNLFLERMITLITFLTNRCRKQQQRTKQSKRHIVPNVNTHP 68

  Fly   230 KFTNFIGKTW----FYAILAVGFLGVYLAAGAGLLLLWEDDWTFFDGFYFCFITMTTIGFGDLVP 290
            : ...|.::|    :|..|.:..:.:.:..||..|....:||::.:..||||:..||:||||:|.
Zfish    69 E-NGDIHESWKPSVYYVTLILAVVALLVNLGASGLYSAMEDWSYLESMYFCFVAFTTMGFGDMVS 132

  Fly   291 KKPN-------YMLLCTLYILIGLALTSTIIE----LVRRQYATSWAKLQELSGPMAETLRRLGE 344
            .:..       |.:..:|.|::|::.|.:::.    ::::......|||..:....:.|..::.|
Zfish   133 GQKAYYEVRWVYQVANSLMIILGVSCTYSLVSVTAIIIKQMLNWILAKLFSMHCCFSITTPKVKE 197

  Fly   345 TA 346
            .|
Zfish   198 AA 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43155NP_572720.2 Ion_trans_2 <157..214 CDD:285168 11/44 (25%)
Ion_trans <240..314 CDD:278921 23/80 (29%)
Ion_trans_2 <266..319 CDD:285168 18/63 (29%)
si:ch211-261a10.5XP_021321992.1 Ion_trans_2 90..172 CDD:311712 21/81 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170590177
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.